The URL can be used to link to this page

PC 2016/11/28 City of Anaheim Planning Commission Agenda Monday, November 28, 2016 Council Chamber, City Hall 200 South Anaheim Boulevard Anaheim, California  Chairperson: Mitchell Caldwell  Chairperson Pro-Tempore: Paul Bostwick  Commissioners: Jess Carbajal, Bill Dalati, Grant Henninger, Michelle Lieberman, John Seymour  Call To Order - 5:00 p.m.  Pledge Of Allegiance  Public Comments  Consent Calendar  Public Hearing Items  Commission Updates  Discussion  Adjournment For record keeping purposes, if you wish to make a statement regarding any item on the agenda, please complete a speaker card in advance and submit it to the secretary. A copy of the staff report may be obtained at the City of Anaheim Planning and Building Department, 200 South Anaheim Boulevard, Anaheim, CA 92805. A copy of the staff report is also available on the City of Anaheim website www.anaheim.net/planning on Wednesday, November 23, 2016, after 5:00 p.m. Any writings or documents provided to a majority of the Planning Commission regarding any item on this agenda (other than writings legally exempt from public disclosure) will be made available for public inspection in the Planning and Building Department located at City Hall, 200 S. Anaheim Boulevard, Anaheim, California, during regular business hours. You may leave a message for the Planning Commission using the following e-mail address: planningcommission@anaheim.net 11-28-2016 Page 2 of 6 APPEAL OF PLANNING COMMISSION ACTIONS Any action taken by the Planning Commission this date regarding Reclassifications, Conditional Use Permits, Variances, Public Convenience or Necessity Determinations, Tentative Tract and Parcel Maps will be final 10 calendar days after Planning Commission action unless a timely appeal is filed during that time. This appeal shall be made in written form to the City Clerk, accompanied by an appeal fee in an amount determined by the City Clerk. The City Clerk, upon filing of said appeal in the Clerk's Office, shall set said petition for public hearing before the City Council at the earliest possible date. You will be notified by the City Clerk of said hearing. If you challenge any one of these City of Anaheim decisions in court, you may be limited to raising only those issues you or someone else raised at the public hearing described in this notice, or in a written correspondence delivered to the Planning Commission or City Council at, or prior to, the public hearing. Anaheim Planning Commission Agenda - 5:00 P.M. Public Comments This is an opportunity for members of the public to speak on any item under the jurisdiction of the Anaheim City Planning Commission or provide public comments on agenda items with the exception of public hearing items. 11-28-2016 Page 3 of 6 Consent Calendar There will be no separate discussion on the item prior to the time of the voting on the motion unless members of the Planning Commission, staff, or the public request the item to be discussed and/or removed from the Consent Calendar for separate action. Reports and Recommendations ITEM NO. 1A FINAL SITE PLAN NO. 2016-00004 (DEV2016-00038) Location: 101 East Katella Avenue Request: The applicant requests approval of a final site plan to construct a 12-story, 352-room hotel, three restaurant tenant spaces and one-level of subterranean parking. Environmental Determination: The Planning Commission will consider if the Final Environmental Impact Report No. 340 is the appropriate environmental document for this project and that none of the conditions set forth in Sections 15162 or 15163 of the State CEQA Guidelines calling for the preparation of a subsequent environmental impact report or a supplement to Final Environmental Impact Report No. 340 have occurred. Resolution No. _____ Project Planner: Elaine Thienprasiddhi ethien@anaheim.net 11-28-2016 Page 4 of 6 Public Hearing Items ITEM NO. 2 CONDITIONAL USE PERMIT NO. 2010-05486G (DEV2009-00083G) Location: 2232 South Harbor Boulevard Request: To amend Conditional Use Permit No. 2010- 05486, approved for the M3Live Anaheim Event Center, an existing theater, restaurant, and banquet facility; the request includes extending the permitted hours of operation and the ability to remove the tables in the theater. Environmental Determination: The Planning Commission will consider whether to find the project to be Categorically Exempt from the provisions of the California Environmental Quality Act and Guidelines as a Class 1 (Existing Facilities) Categorical Exemption. Resolution No. ______ Project Planner: Elaine Thienprasiddhi ethien@anaheim.net ITEM NO. 3 RECLASSIFICATION NO. 2014-00275 TENTATIVE PARCEL MAP NO. 2014-176 (DEV2014-00130) Location: 5055 East Short Street Request: The following land use entitlements are requested to permit the development of a 4-lot, detached single-family residential project: (i) reclassify the subject properties from the T (Transition) Zone to the RS-2 (Single-Family Residential) Zone; and (ii) a tentative parcel map to create a 4-lot single family residential subdivision. Environmental Determination: The Planning Commission will consider whether to find the project to be Categorically Exempt from the provisions of the California Environmental Quality Act and Guidelines as a Class 15 (Minor Land Divisions) Categorical Exemption. Resolution No. ______ Resolution No. ______ Project Planner: Nick Taylor njtaylor@anaheim.net 11-28-2016 Page 5 of 6 ITEM NO. 4 PARCEL A CONDITIONAL USE PERMIT NO. 2016-05860 VARIANCE NO. 2016-05066 DETERMINATION OF PUBLIC CONVENIENCE OR NECESSITY NO. 2016-00131 (DEV2016-00015) Location: 2210 and 2220 East Orangewood Avenue Request: The following land use entitlements are being requested: (i) a conditional use permit to permit the construction of a brew pub to include an event space, an outdoor dining and recreational/entertainment area with on and off-premises sales and consumption of alcoholic beverages, and a coordinated sign program and murals, (ii) a variance to permit fewer parking spaces than required by the Zoning Code; and (iii) a determination of public convenience or necessity to permit a brew pub with on and off-premises sales and consumption of alcoholic beverages. PARCEL B CONDITIONAL USE PERMIT NO. 2016-05890 (DEV2016-00015) Location: 2130 East Orangewood Avenue Request: To permit off-site parking for a brew pub to include an event space and outdoor recreation area located at 2210 and 2220 East Orangewood Avenue. Project Environmental Determination (Parcel A and B): The Planning Commission will consider whether to find the project to be Categorically Exempt from the provisions of the California Environmental Quality Act and Guidelines as a Class 32 (In-Fill Development Projects) Categorical Exemption. The item was continued from the November 14, 2016 Planning Commission meeting. Resolution No. ______ Resolution No. ______ Resolution No. ______ Project Planner: Amy Vazquez avazquez@anaheim.net Adjourn to Monday, December 12, 2016 at 5:00 p.m. 11-28-2016 Page 6 of 6 CERTIFICATION OF POSTING I hereby certify that a complete copy of this agenda was posted at: 1:00 p.m. November 23, 2016 (TIME) (DATE) LOCATION: COUNCIL CHAMBER DISPLAY CASE AND COUNCIL DISPLAY KIOSK SIGNED: ANAHEIM CITY PLANNING COMMISSION The City of Anaheim wishes to make all of its public meetings and hearings accessible to all members of the public. The City prohibits discrimination on the basis of race, color, or national origin in any program or activity receiving Federal financial assistance. If requested, the agenda and backup materials will be made available in appropriate alternative formats to persons with a disability, as required by Section 202 of the Americans with Disabilities Act of 1990 (42 U.S.C. Sec. 12132), and the federal rules and regulations adopted in implementation thereof. Any person who requires a disability-related modification or accommodation, including auxiliary aids or services, in order to participate in the public meeting may request such modification, accommodation, aid or service by contacting the Planning and Building Department either in person at 200 South Anaheim Boulevard, Anaheim, California, or by telephone at (714) 765-5139, no later than 10:00 a.m. one business day preceding the scheduled meeting. La ciudad de Anaheim desea hacer todas sus reuniones y audiencias públicas accesibles a todos los miembros del público. La Ciudad prohíbe la discriminación por motivos de raza , color u origen nacional en cualquier programa o actividad que reciba asistencia financiera federal. Si se solicita, la agenda y los materiales de copia estarán disponible en formatos alternativos apropiados a las personas con una discapacidad, según lo requiere la Sección 202 del Acta de Americanos con Discapacidades de 1990 (42 U.S.C. Sec. 12132), las normas federales y reglamentos adoptados en aplicación del mismo. Cualquier persona que requiera una modificación relativa a la discapacidad, incluyendo medios auxiliares o servicios, con el fin de participar en la reunión pública podrá solicitar dicha modificación, ayuda o servicio poniéndose en contacto con la Oficina de Secretaria de la Ciudad ya sea en persona en el 200 S Anaheim Boulevard, Anaheim, California, o por teléfono al (714) 765-5139, antes de las 10:00 de la mañana un día habil antes de la reunión programada. 200 S. Anaheim Blvd. Suite #162 Anaheim, CA 92805 Tel: (714) 765-5139 Fax: (714) 765-5280 www.anaheim.net ITEM NO. 1-A PLANNING COMMISSION REPORT City of Anaheim PLANNING AND BUILDING DEPARTMENT DATE: NOVEMBER 28, 2016 SUBJECT: FINAL SITE PLAN NO. 2016-00004 LOCATION: 101 East Katella Avenue APPLICANT/PROPERTY OWNER: The applicant is CS Anaheim Hotel Investments, LLC, represented by Matthew B. Kaufman. The property owner is the McNees Family Trust, represented by Charles McNees. REQUEST: The applicant requests approval of a Final Site Plan to construct a 12-story, 352-room hotel, three freestanding restaurant tenant spaces and one-level of subterranean parking. RECOMMENDATION: Staff recommends that the Planning Commission approve the attached resolution, determining that previously-certified Master Environmental Impact Report No. 313 (MEIR NO. 313) and Supplemental Environmental Impact Report No. 340 (SEIR No. 340), along with Mitigation Monitoring Plan No. 337, are the appropriate environmental documentation for this request, and approving Final Site Plan No. 2016-00004. BACKGROUND: This 5.89-acre project site is comprised of three parcels bound by Katella Avenue, Manchester Avenue and Anaheim Boulevard. The site is currently developed with a Del Taco drive-through restaurant, surface parking lot, and two concrete pads where former buildings (The Boogie and Flakey Jake’s) have been demolished. The site is located within the area regulated by the Anaheim Resort Specific Plan (ARSP) and designated for Commercial Recreation land uses by the General Plan. Surrounding land uses include Interstate 5 (I-5) Freeway and southbound off-ramp to Katella Avenue to the north/northeast; Motel 6, Candlewood Suites Anaheim Resort, Peacock Suites Resort Hotel, a commercial laundry, and a 7- 11 convenience market to the west across Anaheim Boulevard; and, a strip retail center and Comfort Inn & Suites to the south across Katella Avenue. PROPOSAL: The applicant proposes to demolish the existing Del Taco drive- through restaurant and construct a new Cambria Suites hotel with 352-rooms. The hotel would include various guest amenities, including a breakfast room, meeting room, bar and lounge, fitness room, game room, and outdoor recreation area. The recreation area would include water slides, two pools, spa, splash pad, movie screen, putting green, and sport court. The development would also include three freestanding quick-service restaurants along Katella Avenue, with a combined area of 15,641 square feet. The three restaurant pads would anchor the southwest corner of the property at Katella Avenue and Anaheim Boulevard; the hotel would be FINAL SITE PLAN NO. 2016-00004 November 28, 2016 Page 2 of 4 situated to the north along Anaheim Boulevard; the outdoor recreation area would be located at the north end of the property; and the remainder of the site would be improved with surface parking, vehicular circulation area and landscaping with one level of subterranean parking located in the center of the site. Vehicle access to the site would be provided by driveways from each of the three abutting streets. The hotel drop off area includes a circular porte cochere and parking for hotel guests would include gate controlled access to the underground parking level. The restaurants would have ample surface parking immediately in front of the restaurants and at the southeast corner of the property. Proposed landscaping includes several shade, flowering and vertical tree species, as well as a variety of shrubs and groundcovers. Landscaping within the public parkway would match the existing landscape design along Katella Avenue and include Date Palms and Giant Agapanthus. Layered landscaping is proposed in all street setbacks, along with a variety of trees to break up the massing of the buildings. Site/Landscape Plan FINAL SITE PLAN NO. 2016-00004 November 28, 2016 Page 3 of 4 The 12-story hotel building would be built to a maximum height of 142 feet including all architectural projections. The architectural style of the hotel and three associated retail buildings is a contemporary design, highlighting the vertical massing of the tower. The base of the hotel would be clad in a porcelain ceramic tile in a random size and color pattern. The middle of the hotel tower wouldinclude light colored, smooth plaster and windows with clear glazing. Vertical accent bands turn at the roof line to provide horizontal canopies. These materials continue on to the restaurant buildings and similar vertical and horizontal elements are incorporated into the three restaurant buildings. Hotel and Restaurants as Viewed from Anaheim Boulevard and Katella Avenue FINDINGS AND ANALYSIS: Final Site Plan: Before the Planning Commission may approve the final plans, it must make a finding of fact that the evidence presented shows that all of the following conditions exist: 1) The design and layout of the proposed development are consistent with the General Plan, any applicable specific plan, the development standards of the applicable zoning district, and any special area guidelines or policies; 2) The design and layout of the proposed development will not interfere with the use and enjoyment of neighboring existing or future developments, and will not create traffic or pedestrian hazards; 3) The architectural design of the proposed development is compatible with the character of the surrounding neighborhood; 4) The design of the proposed development will provide a desirable environment for its occupants, visiting public, and its neighbors, through the appropriate use of materials, texture and color, and will remain aesthetically appealing and be appropriately maintained; and FINAL SITE PLAN NO. 2016-00004 November 28, 2016 Page 4 of 4 5) The proposed development will not be detrimental to the public health, safety or welfare, or materially injurious to the properties or improvements in the vicinity. The ARSP requires approval of a final site plan for hotels to ensure that the proposed design is appropriate for the site, compatible with surrounding land uses and in compliance with specific plan requirements. Staff has reviewed the proposal and has determined that the project complies with all applicable provisions of the ARSP. The proposed hotel project is consistent with the goals and policies of the Anaheim Resort Specific Plan. Environmental Impact Analysis: Previously-certified MEIR No. 313 and SEIR No. 340 were prepared to analyze the environmental impacts associated with implementation of the ARSP. An environmental checklist has been prepared for the proposed project pursuant to the California Environmental Quality Act (CEQA) to determine if the environmental impacts associated with the proposed project were adequately analyzed by the previously-certified EIRs. The analysis in the checklist determined that because the project is consistent with the ARSP, the project has already been adequately analyzed for purposes of CEQA. Mitigation Monitoring Plan No. 337 has been prepared for this project with all applicable mitigation measures from MEIR No. 313 and SEIR No. 340. The mitigation monitoring plan includes certain measures to be complied with prior to approval of the Final Site Plan; these measures have been complied with as part of the review process. CONCLUSION: The proposed development is consistent with the goals and policies of the ARSP. The proposed hotel and restaurants represents a significant positive investment that would enhance the visitor experience by providing additional options for dining and hotel accommodations at this key gateway into the Anaheim Resort. Staff recommends approval of this request. Prepared by, Submitted by, Elaine Thienprasiddhi Jonathan E. Borrego Senior Planner Planning Services Manager Attachments: 1. Development Summary 2. Draft Resolution 3. Final Site Plan Memorandum 4. Photos and Development Plans 5. Initial Study and Mitigation Monitoring Plan No. 337 SP 92-2DA1RETAIL I (SABC)VACANT SP 92-2DA1ARENA INN & SUITES SP 92-2DA1COMFORT INN& SUITES SP 92-2DA1AMERICANLINENSUPPLY SP 93-1 HOTEL CIRCLECANDLEWOOD SUITESANAHEIM RESORT SP 92-2DA1VACANT SP 92-2DA1SERVICESTATION SP 92-2DA1RETAIL SP 93-1 HOTEL CIRCLEPEACOCKSUITESRESORTHOTEL SP 92-2DA1MOTEL 6 SP 92-2DA1RETAIL 5 FREEWAY 5 FREEWAY E KATELLA AVE S M ANCHESTER AVE S A N A H E I M B L V D W DISNEY WAY S H A S T E R S T W KATELLA AVE W DISNEY WAY S ANAHEIM WAY VANGUARD RD S R O C K E T S . H A R B O R B L V D S . L E W I S S T E. KATELLA AVE E. CERRITOS AVE W. KATELLA AVE S . W E S T S T S . S T A T E C O L L E G E B L V D E. ORANGEWOOD AVE S . H A S T E R S T W.ORANGEWOODAVE E. GENE AUTRY WAYS. D I S N E Y L A N D D R 101 East Katella Avenue DEV No. 2016-00038 Subject Property APN: 082-230-73082-230-77082-230-72 °0 50 100 Feet Aerial Photo:June 2015 5 FREEWAY 5 FREEWAY E KATELLA AVE S M ANCHESTER AVE S A N A H E I M B L V D W DISNEY WAY S H A S T E R S T W KATELLA AVE W DISNEY WAY S ANAHEIM WAY VANGUARD RD S R O C K E T S . H A R B O R B L V D S . L E W I S S T E. KATELLA AVE E. CERRITOS AVE W. KATELLA AVE S . W E S T S T S . S T A T E C O L L E G E B L V D E. ORANGEWOOD AVE S . H A S T E R S T W.ORANGEWOODAVE E. GENE AUTRY WAYS. D I S N E Y L A N D D R 101 East Katella Avenue DEV No. 2016-00038 Subject Property APN: 082-230-73082-230-77082-230-72 °0 50 100 Feet Aerial Photo:June 2015 ATTACHMENT NO. 1 DEVELOPMENT SUMMARY Development Standard Proposed Project ARSP Standards Site Area 5.89 acres --- Density 352 rooms, plus the retail equivalent of 27 rooms (600 sf of accessory retail area equals one room) 725 rooms maximum Street Setbacks Katella Avenue Anaheim Boulevard Manchester Avenue 11 to 15 feet 20 feet 20 feet 11 feet minimum 20 feet minimum 20 feet minimum Front Landscape Tree Density1 Katella Avenue Anaheim Boulevard Manchester Avenue 3,000 points 5,475 points 5,550 points 2,168 points minimum 3,604 points minimum 4,812 points minimum Building Height 142 feet 183 feet Parking 440 spaces 440 spaces 1 Tree density is calculated by multiplying the size (in square feet) of the landscape area and by a Tree Density Factor (0.3 at this location) to determine a minimum point value. Trees proposed in the landscape area are assigned a point value based on their size at installation. [DRAFT] ATTACHMENT NO. 2 -1- PC2016-*** RESOLUTION NO. PC2016-*** A RESOLUTION OF THE PLANNING COMMISSION OF THE CITY OF ANAHEIM DETERMINING THAT THE PREVIOUSLY-CERTIFIED FINAL SUPPLEMENTAL ENVIRONMENTAL IMPACT REPORT NO. 340 SERVES AS THE APPROPRIATE ENVIRONMENTAL DOCUMENTATION AND APPROVING FINAL SITE PLAN NO. 2016-00004 AND MAKING CERTAIN FINDINGS IN CONNECTION THEREWITH (DEV2016-00038) (101 EAST KATELLA AVENUE) WHEREAS, the Planning Commission of the City of Anaheim (hereinafter referred to as the “Planning Commission”) did receive a verified Petition for Final Site Plan No. 2016-00004 to construct a 12-story, 352-room hotel, three restaurant tenant spaces and one-level of subterranean parking (collectively referred to herein as the "Proposed Project") for certain real property located at 101 East Katella Avenue in the City of Anaheim, County of Orange, State of California, as generally depicted on the map attached hereto as Exhibit A and incorporated herein by this reference (the “Property”); and WHEREAS, the Property, consisting of approximately 5.89 acres, is developed with a Del Taco drive-through restaurant, surface parking lot, and two concrete pads where former buildings have been demolished. The Anaheim General Plan designates the Property for Commercial Recreation land uses. The Property is located within the boundaries of the Commercial Recreation (C-R) District (Development Area 1) of the the Anaheim Resort Specific Plan area and is subject to the zoning and development standards set forth in Section 18.116.060 (Development Density Areas – Commercial Recreation (C-R) District (Development Area 1)) and Section 18.116.070 (Uses – Commercial Recreation (C-R) District (Development Area 1)) of Chapter 18.116 (Anaheim Resort Specific Plan No. 92-2 (SP 92-2) Zoning and Development Standards) of Title 18 (Zoning) of the Anaheim Municipal Code (the "Code"); and WHEREAS, on September 20, 1994, the City Council adopted the Anaheim Resort Specific Plan to provide a long-range comprehensive plan for future development of approximately 549.5 acres surrounding The Disneyland Resort and Hotel Circle. The Anaheim Resort Specific Plan includes zoning and development standards, design guidelines, a streetscape program, and a public facilities plan, intended to maximize the area’s potential, guide future development, and ensure a balance between growth and infrastructure. The Anaheim Resort Specific Plan permits the development of hotel, convention, retail, and other visitor-serving uses as well as the infrastructure improvements that are needed to support future development; and WHEREAS, in support of the adoption of the Anaheim Resort Specific Plan, the City Council certified the Master Environmental Impact Report for the Anaheim Resort Specific Plan (“MEIR No. 313”) by the adoption on September 20, 1994 of its Resolution No. 94R-234; and WHEREAS, by Resolution No. 2012-158, the City Council certified Final Supplemental Environmental Impact Report No. 2008-00340 for Amendment No. 14 to the Anaheim Resort Specific Plan ("Final EIR No. 340") (which Final EIR No. 340 included mitigation measures, a water supply assessment, a statement of overriding considerations and findings thereto), which -2- PC2016-*** reevaluated all of the environmental changes that had occurred in and around the Anaheim Resort Specific Plan Area since its adoption in 1994 and contained an analysis of the potential environmental impacts of various entitlements and actions referenced therein, including, inter alia, entitlements permitting the maximum build-out of the Anaheim Resort Specific Plan, including an increase of up to 406,359 square feet of convention center space, 180,000 square feet of commercial development, 900 hotel rooms, and 40,000 square feet of hotel meeting/ballroom space; and WHEREAS, Chapter 18.116 (Anaheim Resort Specific Plan No. 92-2 (SP 92-2) Zoning and Development Standards) prescribes the methods and procedures for implementation of the Anaheim Resort Specific Plan, which for the Proposed Project requires the processing and approval of a Final Site Plan in accordance with Chapter 18.70 (Final Site Plans) of Title 18 (Zoning) of the Code prior to the issuance of building permits; and WHEREAS, pursuant to and in accordance with the provisions of the California Environmental Quality Act (Public Resources Code Section 21000 et seq.; herein referred to as “CEQA”), the State of California Guidelines for the Implementation of the California Environmental Quality Act (commencing with Section 15000 of Title 14 of the California Code of Regulations; herein referred to as the "CEQA Guidelines"), and the City's Local CEQA Procedure Manual, the City is the "lead agency" for the preparation and consideration of environmental documents for the Proposed Project; and WHEREAS, pursuant to paragraph .0204 (Environmental Review) of subsection .020 (Final Site Plan Review and Approval) of Section 18.116.040 (Methods and Procedures for Specific Plan Implementation) of Chapter 18.116 (Anaheim Resort Specific Plan No. 92-2 (SP 92-2) Zoning and Development Standards) of the Code, the Planning Commission hereby finds and determines that, in accordance with CEQA, the CEQA Guidelines, and the City's Local CEQA Procedure Manual, the approvals required under CEQA for the Proposed Project have been made pursuant to the prior certification of MEIR No. 313 and Final EIR No. 340, prior approvals of related resolutions and ordinances, and the prior filing of a notice of determination; and WHEREAS, the Planning Commission further finds and determines that Final EIR No. 340 will serve as the appropriate environmental documentation in connection with the Proposed Project and that none of the conditions set forth in Sections 15162 or 15163 of the CEQA Guidelines calling for the preparation of a subsequent environmental impact report or a supplement to Final EIR No. 340 have occurred; specifically: a. There have not been any substantial changes in the project analyzed in Final EIR No. 340 that require major revisions of Final EIR No. 340 because of new significant environmental effects or a substantial increase in the severity of previously identified significant effects; b. There have not been any substantial changes with respect to the circumstances under which the Proposed Project is undertaken that require major revisions of Final EIR No. 340 due to the involvement of new significant environmental effects or a substantial increase in the severity of previously identified significant effects; and -3- PC2016-*** c. There is no new information of substantial importance, which was not known and could not have been known with the exercise of reasonable diligence at the time Final EIR No. 340 was certified as complete was adopted, that shows any of the following: (a) the Proposed Project will have one or more significant effects not discussed in Final EIR No. 340; (b) significant effects previously examined will be substantially more severe than shown in Final EIR No. 340; (c) mitigation measures or alternatives previously found not to be feasible would in fact be feasible and would substantially reduce one or more significant effects of the Proposed Project, but the project proponents decline to adopt the mitigation measures or alternatives; or (d) mitigation measures or alternatives which are considerably different from those analyzed in Final EIR No. 340 would substantially reduce one or more significant effects on the environment, but the project proponents decline to adopt the mitigation measures or alternatives; and BE IT FURTHER RESOLVED that the Planning Commission has reviewed and considered Mitigation Monitoring Plan No. 337 ("MMP No. 337"), which is attached hereto as Exhibit B and incorporated herein by this reference, which was prepared for the Proposed Project and includes mitigation measures specific to the Proposed Project, and, in accordance with the requirements of CEQA, finds and determines that, with the imposition of the mitigation measures identified in MMP No. 337, the Proposed Project will not result in any new significant impacts to the environment and there is no substantial evidence that the Proposed Project will have a significant effect on the environment; and WHEREAS, the Planning Commission finds and determines that the Proposed Project does not exceed the maximum hotel room density allowed in the Commercial Recreation (C-R) District (Development Area 1) under Section 18.116.060 (Development Density Areas – Commercial Recreation (C-R) District (Development Area 1)); and WHEREAS, the Planning Commission does find and determine that the request for a Final Site Plan for the Proposed Project should be approved for the following reasons: 1. Subject to compliance with the conditions of approval attached to this Resolution as Exhibit B and incorporated herein by this reference, the Final Site Plan, including its design and layout, complies with the Anaheim Resort Specific Plan No. 92-2 and is consistent with the zoning and development standards of said Specific Plan, as described in Chapter 18.116 of the Code. 2. The design and layout of the Proposed Project will not interfere with the use and enjoyment of neighboring existing or future developments, and will not create traffic or pedestrian hazards. 3. The architectural design of the Proposed Project is compatible with the character of the surrounding hotels and development located within the land area of the Anaheim Resort Specific Plan. 4. The design of the Proposed Project will provide a desirable environment for its occupants, the visiting public, and its neighbors, through the appropriate use of materials, texture and color, and will remain aesthetically appealing and be appropriately maintained. -4- PC2016-*** 5. The Proposed Project will not be detrimental to the public health, safety or welfare, or materially injurious to the properties or improvements in the vicinity of the Proposed Project. WHEREAS, the Planning Commission determines that the evidence in the record constitutes substantial evidence to support the actions taken and the findings made in this Resolution, that the facts stated in this Resolution are supported by substantial evidence in the record, including testimony received at the public hearing, the staff presentation, the staff report and all materials in the project files. There is no substantial evidence, nor are there other facts, that detract from the findings made in this Resolution. The Planning Commission expressly declares that it considered all evidence presented and reached these findings after due consideration of all evidence presented to it. NOW, THEREFORE, BE IT RESOLVED that the Planning Commission, pursuant to the above findings and based upon a thorough review of the evidence received to date, does hereby approve Final Site Plan No. 2016-00004, contingent upon and subject to the conditions of approval, attached hereto as Exhibit B and incorporated herein by this reference. Said conditions are hereby found to be a necessary prerequisite to the proposed use of the Property in order to preserve the health, safety and general welfare of the citizens of the City of Anaheim. Timing for compliance with conditions of approval may be amended by the Planning Director upon a showing of good cause provided (i) equivalent timing is established that satisfies the original intent and purpose of the condition(s), (ii) the modification complies with the Code, and (iii) the applicant has demonstrated significant progress toward establishment of the use or approved development. BE IT FURTHER RESOLVED that the Planning Commission has reviewed and considered MMP No. 337, which is integrated with the aforementioned conditions of approval and together are represented as Exhibit B hereto, and does hereby approve and adopt MMP No. 337 for the Proposed Project. BE IT FURTHER RESOLVED that the Planning Commission does hereby find and determine that adoption of this Resolution is expressly predicated upon applicant's compliance with each and all of the conditions hereinabove set forth. Should any such condition, or any part thereof, be declared invalid or unenforceable by the final judgment of any court of competent jurisdiction, then this Resolution, and any approvals herein contained, shall be deemed null and void. BE IT FURTHER RESOLVED that approval of this application constitutes approval of the proposed request only to the extent that it complies with the Code and any other applicable City, State and Federal regulations. Approval does not include any action or findings as to compliance or approval of the request regarding any other applicable ordinance, regulation or requirement. BE IT FURTHER RESOLVED, that any amendment, modification or revocation of this permit may be processed in accordance with Chapters 18.60.190 (Amendment to Permit Approval) and 18.60.200 (City-Initiated Revocation or Modification of Permits) of the Code. -5- PC2016-*** THE FOREGOING RESOLUTION was adopted at the Planning Commission meeting of November 28, 2016. Said resolution is subject to the appeal provisions set forth in Chapter 18.60 (Procedures) of the Anaheim Municipal Code pertaining to appeal procedures and may be replaced by a City Council Resolution in the event of an appeal. CHAIRPERSON, PLANNING COMMISSION OF THE CITY OF ANAHEIM ATTEST: SECRETARY, PLANNING COMMISSION OF THE CITY OF ANAHEIM STATE OF CALIFORNIA ) COUNTY OF ORANGE ) ss. CITY OF ANAHEIM ) I, Eleanor Morris, Secretary of the Planning Commission of the City of Anaheim, do hereby certify that the foregoing resolution was passed and adopted at a meeting of the Planning Commission of the City of Anaheim held on November 28, 2016, by the following vote of the members thereof: AYES: COMMISSIONERS: NOES: COMMISSIONERS: ABSENT: COMMISSIONERS: IN WITNESS WHEREOF, I have hereunto set my hand this 28th day of November, 2016. SECRETARY, PLANNING COMMISSION OF THE CITY OF ANAHEIM -6- PC2016-*** -7- PC2016-*** EXHIBIT “B” FINAL SITE PLAN NO. 2016-00004 (DEV2016-00038) NO. CONDITIONS OF APPROVAL RESPONSIBLE DEPARTMENT PRIOR TO ISSUANCE OF DEMOLITION PERMITS 1 MM 5.2-4: Prior to issuance of each grading permit (for Import/Export Plan) and prior to issuance of demolition permit (for Demolition Plan), the property owner/developer shall submit Demolition and Import/Export plans. The plans shall include identification of offsite locations for materials export from the project and options for disposal of excess material. These options may include recycling of materials onsite, sale to a soil broker or contractor, sale to a project in the vicinity or transport to an environmentally cleared landfill, with attempts made to move it within Orange County. The property owner/developer shall offer recyclable building materials, such as asphalt or concrete for sale or removal by private firms or public agencies for use in construction of other projects, if not all can be reused on the project site. Planning and Building 2 MM 5.3-1: Prior to the issuance of a demolition permit, grading permit, or building permit, whichever occurs first, a survey for active raptor nests shall be conducted by a qualified Biologist and submitted to the Planning and Building Department 30 days prior to commencement of any demolition or construction activities during the raptor nesting season (February 1 to June 30) and within 500 feet of a fan palm, juniper, or canary island pine. Should an active nest be identified, restrictions defined by a qualified Biologist will be placed on construction activities in the vicinity of any active nest observed until the nest is no longer active, as determined by a qualified Biologist. These restrictions may include a 300- to 500-foot buffer zone designated around a nest to allow construction to proceed while minimizing disturbance to the active nest. Once the nest is no longer active, construction can proceed within the buffer zone. Planning and Building 3 MM 5.3-2: Prior to the issuance of a demolition permit, grading permit, or building permit, whichever occurs first, a letter detailing the proposed schedule for vegetation removal activities shall be submitted to the Planning and Building Department, verifying that removal shall take place between August 1 and February 28 to avoid the bird nesting season. This would ensure that no active nests would be disturbed. If this is not feasible, then a qualified Biologist shall inspect any trees which would be impacted prior to demolition, grading or construction activities to ensure no nesting birds are present. If a nest is present, then appropriate minimization measures shall be developed by the Biologist. Planning and Building 4 MM 5.7-4: Prior to issuance of the first grading or demolition permit, whichever occurs first the property owner/developer shall submit a plan for review and approval by the Fire Department which details procedures that will be taken if previously unknown USTs, or other unknown hazardous material or waste, is discovered onsite. Fire -8- PC2016-*** NO. CONDITIONS OF APPROVAL RESPONSIBLE DEPARTMENT PRIOR TO ISSUANCE OF GRADING PERMIT 5 MM 5.4-1: Prior to issuance of each grading permit, the property owner/developer shall submit a letter identifying the certified archaeologist that has been hired to ensure that the following actions are implemented: a. The archaeologist must be present at the pre-grading conference in order to establish procedures for temporarily halting or redirecting work to permit the sampling, identification, and evaluation of artifacts if potentially significant artifacts are uncovered. If artifacts are uncovered and determined to be significant, the archaeological observer shall determine appropriate actions in cooperation with the property owner/developer for exploration and/or salvage. b. Specimens that are collected prior to or during the grading process will be donated to an appropriate educational or research institution. c. Any archaeological work at the site shall be conducted under the direction of the certified archaeologist. If any artifacts are discovered during grading operations when the archaeological monitor is not present, grading shall be diverted around the area until the monitor can survey the area. d. A final report detailing the findings and disposition of the specimens shall be submitted to the City Engineer. Upon completion of the grading, the archaeologist shall notify the City as to when the final report will be submitted. Public Works 6 MM 5.4-2: Prior to issuance of each grading permit, the property owner/developer shall submit a letter identifying the certified paleontologist that has been hired to ensure that the following actions are implemented: a. The paleontologist must be present at the pre-grading conference in order to establish procedures to temporarily halt or redirect work to permit the sampling, identification, and evaluation of fossils if potentially significant paleontological resources are uncovered. If artifacts are uncovered and found to be significant, the paleontological observer shall determine appropriate actions in cooperation with the property owner/developer for exploration and/or salvage. b. Specimens that are collected prior to or during the grading process will be donated to an appropriate educational or research institution. c. Any paleontological work at the site shall be conducted under the direction of the certified paleontologist. If any fossils are discovered during grading operations when the paleontological monitor is not present, grading shall be diverted around the area until the monitor can survey the area. Public Works 7 MM 5.5-6: Prior to issuance of building or grading permits, the property owner/developer shall submit to the Planning and Building Department, Building Services Division geologic and geotechnical investigations in areas of potential seismic or geologic hazards and provide a note on plans that all grading operations will be conducted in conformance with the recommendations contained in the applicable geotechnical investigation. Planning and Building 8 MM 5.8-1: Prior to issuance of the first grading or building permit, whichever occurs first, the property owner/developer shall submit a Master Drainage and Runoff Management Plan (MDRMP) for review and approval by the Public Works Department, Development Services Division and Orange County (OC) Public Works -9- PC2016-*** NO. CONDITIONS OF APPROVAL RESPONSIBLE DEPARTMENT Public Works/OC Engineering. The Master Plan shall include, but not be limited to, the following items: a. Backbone storm drain layout and pipe size, including supporting hydrology and hydraulic calculations for storms up to and including the 100-year storm; and, b. A delineation of the improvements to be implemented for control of project- generated drainage and runoff. 9 MM 5.8-2: Prior to issuance of a grading permit for sites that disturb more than one (1) acre of soil, the property owner/developer shall obtain coverage under the NPDES Statewide Industrial Stormwater Permit for General Construction Activities from the State Water Resources Control Board. Evidence of attainment shall be submitted to the Public Works Department, Development Services Division. Public Works 10 MM 5.12-6: Prior to issuance of each grading permit, the property owner/developer shall submit an emergency fire access plan to the Fire Department for review and approval to ensure that service to the site is in accordance with Fire Department service requirements. Fire 11 MM 5.14-3: Prior to approval of the first final subdivision map or issuance of the first building permit, whichever occurs first, the property owner/developer shall irrevocably offer for dedication (with subordination of easements), including necessary construction easements, the ultimate arterial highway right(s)-of-way adjacent to their property as shown in the Circulation Element of the Anaheim General Plan. Public Works 12 MM 5.14-5: Prior to the issuance of grading permits, the property owner/developer shall provide to the City of Anaheim Public Works Department a plan to coordinate rideshare services for construction employees with the Anaheim Transportation Network (ATN) for review and a approval and shall implement ATN recommendations to the extent feasible. Public Works 13 MM 5.14-19: Prior to the approval of the final subdivision map or issuance of building permits, whichever occurs first, the property owner/developer shall pay the identified fair-share responsibility as determined by the City as set forth in MM 5.14-15. The City shall allocate the property owner/developer’s fair-share contribution to traffic mitigation programs that result in improved traffic flow on the impacted mainline and ramp locations, via an agreement mutually acceptable to Caltrans and the City. Public Works 14 MM 5.16-1: Prior to approval of a final subdivision map or issuance of a grading or building permit, whichever occurs first, the property owner/developer shall participate in the City’s Master Plan of Sewers and related Infrastructure Improvement (Fee) Program to assist in mitigating existing and future sanitary sewer system deficiencies as follows: The property owner/developer shall submit a report for review and approval of the City Engineer to assist in determining the following: a. If the development/redevelopment (1) does not discharge into a sewer system that is currently deficient or will become deficient because of that discharge and/or (2) does not increase flows or change points of discharge, then the property owner’s/developer’s responsibility shall be limited to participation in the Infrastructure Improvement (Fee) Program. Public Works -10- PC2016-*** NO. CONDITIONS OF APPROVAL RESPONSIBLE DEPARTMENT b. If the development/redevelopment (1) discharges into a sewer system that is currently deficient or will become deficient because of that discharge and/or (2) increases flows or changes points of discharge, then the property owner/developer shall be required to guarantee mitigation to the satisfaction of the City Engineer and the City Attorney of the impact prior to approval of a final subdivision map or issuance of a grading or building permit whichever occurs first, pursuant to the improvements identified in the South Central Area Sewer Deficiency Study. The property owner/developer shall be required to install the sanitary sewer facilities, as recommended by the South Central Area Sewer Deficiency Study, prior to acceptance for maintenance of public improvements by the City or final building and zoning inspections for the building/structure, whichever comes first. Additionally, the property owner/developer shall participate in the Infrastructure Improvement (Fee) Program, as determined by the City Engineer, which may include fees, credits, reimbursements, or a combination thereof. As part of guaranteeing the mitigation of impacts for the sanitary sewer system, the property owner/developer shall submit a sanitary sewer system improvement phasing plan for the project to the City Engineer for review and approval which shall contain, at a minimum, (1) a layout of the complete system, (2) all facility sizes, including support calculations, (3) construction phasing, and (4) construction estimates. The study shall determine the impact of the project sewer flows for total build out of the project and identify local deficiencies for each project component (i.e., each hotel). 15 MM 5.18-1: Prior to approval of a final subdivision map, or issuance of a grading or building permit, whichever occurs first, the property owner/developer shall participate in the City’s Master Plan of Storm Drains and related Infrastructure Improvement (Fee) Program to assist in mitigating existing and future storm drainage system deficiencies as follows: The property owner/developer shall submit a report for review and approval by the City Engineer to assist with determining the following: a. If the specific development/redevelopment does not increase or redirect current or historic storm water quantities/flows, then the property owner/developer’s responsibility shall be limited to participation in the Infrastructure Improvement (Fee) Program to provide storm drainage facilities in 10- and 25-year storm frequencies and to protect properties/structures for a 100-year storm frequency. b. If the specific development/redevelopment increases or redirects the current or historic storm water quantity/flow, then the property owner/developer shall be required to guarantee mitigation to the satisfaction of the City Engineer and City Attorney’s office of the impact prior to approval of a final subdivision map or issuance of a grading or building permit, whichever occurs first, pursuant to the improvements identified in the Master Plan of Drainage for the South Central Area. The property owner/developer shall be required to install the storm drainage facilities as recommended by the Master Plan of Drainage for the South Central Area to provide storm drainage facilities for 10- and 25- year storm frequencies and to protect properties/structures for a 100-year Public Works -11- PC2016-*** NO. CONDITIONS OF APPROVAL RESPONSIBLE DEPARTMENT storm frequency prior to acceptance for maintenance of public improvements by the City or final building and zoning inspection for the building/structure, whichever occurs first. Additionally, the property owner/developer shall participate in the Infrastructure Improvement (Fee) Program as determined by the City Engineer which could include fees, credits, reimbursements, or a combination thereof. As part of guaranteeing the mitigation of impacts on the storm drainage system, a storm drainage system improvement phasing plan for the project shall be submitted by the property owner/developer to the City Engineer for review and approval and shall contain, at a minimum, (1) a layout of the complete system; (2) all facility sizes, including support calculations; (3) construction phasing; and, (4) construction estimates. 16 MM 5.19-5: Prior to issuance of each grading and building permit, the Property Owner/Developer shall submit to the Planning Director or Planning Services Manager for approval a Construction Waste Management Plan that, at a minimum, specifies that at least 75 percent of non-hazardous construction and demolition debris shall be recycled or salvaged and identifies the materials to be diverted from disposal and whether the materials will be sorted on site or co-mingled. Planning and Building PRIOR TO ISSUANCE OF BUILDING PERMITS 17 MM 5.14-14: Prior to the issuance of building permits or final map approval, whichever occurs first, security in the form of a bond, certificate of deposit, letter of credit, completion guarantee, or cash, in an amount and form satisfactory to the City Engineer shall be posted with the City to guarantee the satisfactory completion of all engineering requirements of the City of Anaheim, including preparation of improvement plans and installation of all improvements, such as curbs and gutters, sidewalks, water facilities, street grading and pavement, sewer and drainage facilities and other appurtenant work, as required by the City Engineer and in accordance with the specifications on file in the office of the City Engineer, as may be modified by the City Engineer. Installation of said improvements shall occur prior to final building and zoning inspections. Public Works ONGOING DURING PROJECT DEMOLITION AND CONSTRUCTION 18 MM 5.5-5: Ongoing during grading activities, the property owner/developer shall implement standard practices for all applicable codes and ordinances to prevent erosion to the satisfaction of the Planning and Building Department, Building Services Division. Planning and Building 19 MM 5.7-6: Ongoing during project demolition and construction, in the event that hazardous waste, including asbestos, is discovered during site preparation or construction, the property owner/developer shall ensure that the identified hazardous waste and/or hazardous material are handled and disposed of in the manner specified by the State of California Hazardous Substances Control Law (Health and Safety Code, Division 20, Chapter 6.5), and according to the requirements of the California Administrative Code, Title 30, Chapter 22. Fire 20 MM 5.7-3: Ongoing during remediation, all remediation activities of surface or subsurface contamination not related to USTs, conducted on behalf of the property owner/developer, shall be overseen by the Orange County Health Care Agency (OCHCA). Information on subsurface contamination from USTs shall be provided to the Public Utilities Department, Environmental Services Division. Santa Ana Regional Water Quality Control Board (SARWQCB) with a copy to Planning Fire Department Public Utilities Department -12- PC2016-*** NO. CONDITIONS OF APPROVAL RESPONSIBLE DEPARTMENT & Building. Note: Per a memo dated October 22, 2014 from the Public Utilities Department, as of July 1, 2014, the Environmental Services Division of the Public Utilities Department is no longer responsible for overseeing the cleanup of new UST cases, and the responsibility has been delegated to the Santa Ana Regional Water Quality Control Board (SARWQCB). However, the Anaheim Fire Department will still be responsible for overseeing the removal of USTs. (amended February 26, 2015). Planning & Building PRIOR TO THE PLACEMENT OF BUILDING MATERIALS ON A BUILDING SITE 21 MM 5.12-13: Prior to the placement of building materials on a building site, an all-weather road shall be provided from the roadway system to and on the construction site and for fire hydrants at all times, as required by the Fire Department. Such routes shall be paved or, subject to the approval of the Fire Department, shall otherwise provide adequate emergency access. Every building constructed must be accessible to Fire Department apparatus. The width and radius of the driving surface must meet the requirements of Section 10.204 of the Uniform Fire Code, as adopted by the City of Anaheim. Fire PRIOR TO THE PLACEMENT OF BUILDING MATERIALS ON A BUILDING SITE 22 MM 5.12-5: Prior to commencement of structural framing on each parcel or lot, onsite fire hydrants shall be installed and charged by the property owner/developer as required and approved by the Fire Department. Fire PRIOR TO ISSUANCE OF BUILDING PERMITS 23 MM 5.1-2: Prior to issuance of building permits, all plumbing or other similar pipes and fixtures located on the exterior of the building shall be shown on plans as fully screened from view of adjacent public rights-of-way and from adjacent properties by architectural devices and/or appropriate building materials. A note indicating that these improvements will be installed prior to final building and zoning inspections shall be specifically shown on the plans submitted for building permits. Planning and Building 24 MM 5.1-11: Prior to issuance of each building permits, unless records indicate previous payment, a fee for street tree purposes shall be paid or cause to be paid to the City of Anaheim based on the length of street frontage in an amount as established by City Council resolution or credit against the fee given for City authorized improvements installed by the property owner/developer. Planning and Building 25 MM 5.1-12: Prior to issuance of each building permit, all air conditioning facilities and other roof and ground-mounted equipment shall be shown on plans as shielded from public view and the sound buffered to comply with City of Anaheim noise ordinances from any adjacent residential or transient-occupied properties. A note indicating that these improvements shall be installed prior to final building and zoning inspections shall be specifically shown on the plans submitted for building permits. Planning and Building 26 MM 5.2-2: Prior to the issuance of each building permit, the property owner/developer shall submit evidence that low emission paints and coatings are utilized in the design and construction of buildings, in compliance with SCAQMD regulations. The information shall be denoted on the project plans and specifications. The property owner/developer shall submit an architectural coating Planning and Building -13- PC2016-*** NO. CONDITIONS OF APPROVAL RESPONSIBLE DEPARTMENT schedule and calculations demonstrating that VOC emissions from architectural coating operations would not exceed 75 pounds per day averaged over biweekly periods. The calculations shall show, for each coating, the surface area to be coated, gallons (or liters) of coating per unit surface area, and VOC content per gallon (or liter). The property owner/developer shall also implement the following to limit emissions from architectural coatings and asphalt usage: a. Use non-solvent-based coatings on buildings, wherever appropriate; b. Use solvent-based coatings, where they are necessary. 27 MM 5.2-6: Prior to the issuance of each building permit, the property owner/developer shall implement, and demonstrate to the City, measures that are being taken to reduce operation-related air quality impacts. These measures may include, but are not limited to the following: a. Improve thermal integrity of structures and reduced thermal load through use of automated time clocks or occupant sensors. b. Incorporate efficient heating and other appliances. c. Incorporate energy conservation measures in site orientation and in building design, such as appropriate passive solar design. d. Use drought-resistant landscaping wherever feasible to reduce energy used in pumping and transporting water. e. To the extent feasible, provide daycare opportunities for employees or participate in a joint development daycare center f. Install facilities for electric vehicle recharging, unless it is demonstrated that the technology for these facilities or availability of the equipment current at the time makes this installation infeasible. Planning and Building 28 MM 5.5-1: Prior to issuance of each building permit, the property owner/developer shall submit to the Planning and Building Department, Building Services Division for review and approval, detailed foundation design information for the subject building(s), prepared by a civil engineer, based on recommendations by a geotechnical engineer. Planning and Building 29 MM 5.5-2: Prior to issuance of each foundation permit, the property owner/developer shall submit a report prepared by a geotechnical engineer to the Planning and Building Department, Building Services Division for review and approval, which shall investigate the subject foundation excavations to determine if soft layers are present immediately beneath the footing site and to ensure that compressibility does not underlie the footing. Planning and Building 30 MM 5.5-3: Prior to issuance of each building permit, the property owner/developer shall submit plans to the Planning Department, Building Services Division for review and approval showing that the proposed structure has been analyzed for earthquake loading and designed according to the most recent seismic standards in the California Building Code adopted by the City of Anaheim. Planning and Building 31 MM 5.8-6: Prior to issuance of building permits, the property owner/developer shall provide written evidence that all storm drain, sewer, and street improvement plans shall be designed and constructed to the satisfaction of the City Engineer. Public Works 32 MM 5.10-3: Prior to issuance of each building permit, for structures that are adjacent to noise-sensitive areas such as residences, the property owner/developer Planning and Building -14- PC2016-*** NO. CONDITIONS OF APPROVAL RESPONSIBLE DEPARTMENT shall ensure that all mechanical ventilation units are shown on plans and installed in compliance with Sound Pressure Level Ordinance. 33 MM 5.10-5: Prior to issuance of each building permit, a note shall be provided on building plans indicating that during construction, the property owner/developer shall install and maintain specially designed construction barriers at the project perimeter areas. The construction sound barriers shall be a minimum height of 8 feet with a minimum surface weight of 1.25 pounds per square foot or a minimum Sound Transmission Class (STC) rating of 25. The structure shall be a continuous barrier. Gates and other entry doors shall be constructed with suitable mullions, astragals, seals, or other design techniques to minimize sound leakage when in the closed position. Access doors should be self closing where feasible. Vision ports are permissible providing they are filled with an acceptable solid vision product. Planning and Building 34 MM 5.10-9: Prior to issuance of each building permit, the property owner/developer shall present plans and calculations to the Planning Department, Building Division to demonstrate that noise levels would be less than 65 dBA CNEL for outdoor use areas (including dining patios, pools, playgrounds, or outdoor gathering areas). This requirement can be accomplished through shielding areas behind buildings or the construction of a noise barrier. Planning and Building 35 MM 5.10-10: Prior to issuance of each building permit, the property owner/developer shall present plans and calculations to the Planning and Building Department, Building Division to demonstrate that noise levels from planned mechanical ventilation equipment, loading docks, trash compactors, and other proposed on-site noise sources are designed to meet the City’s 60 dBA Sound Pressure Levels standard at the property line, and not create a noise increase greater than 5 dBA over existing ambient noise at the nearest noise sensitive receptor, whichever is more restrictive. Planning and Building 36 MM 5.10-12: Prior to issuance of each building permit if pile driving and blasting is anticipated during construction, a noise and vibration analysis must be prepared and submitted to the Planning and Building Department, Building Division, to assess and mitigate potential noise and vibration impacts related to these activities. Planning and Building 37 MM 5.12-2: Prior to the issuance of each building permit for a parking structure, the property owner/developer shall submit plans to the Police Department for review and approval indicating the provision of closed circuit television monitoring and recording or other substitute security measures as may be approved by the Police Department. Said measures shall be implemented prior to final building and zoning inspections. Police 38 MM 5.12-4: Prior to issuance of each building permit, the project design shall include parking lots and parking structures with controlled access points to limit ingress and egress if determined to be necessary by the Police Department, and shall be subject to the review and approval of the Police Department. Police 39 MM 5.12-7: Prior to issuance of each building permit; to be implemented prior to the final building and zoning inspection, plans shall indicate that all buildings, exclusive of parking structures, shall have sprinklers installed by the property owner/developer in accordance with the Anaheim Municipal Code. Said sprinklers shall be installed prior to each final building and zoning inspection. Fire 40 MM 5.12-8: Prior to issuance of each building permit, plans shall be submitted to ensure that development is in accordance with the City of Anaheim Fire Fire -15- PC2016-*** NO. CONDITIONS OF APPROVAL RESPONSIBLE DEPARTMENT Department Standards, including: a. Overhead clearance shall not be less than 14 feet for the full width of access roads. b. Bridges and underground structures to be used for Fire Department access shall be designed to support Fire Department vehicles weighing 75,000 pounds. c. All underground tunnels shall have sprinklers. Water supplies are required at all entrances. Standpipes shall also be provided when determined to be necessary by the Fire Department. d. Adequate off-site public fire hydrants contiguous to the Specific Plan area and onsite private fire hydrants shall be provided by the property owner/developer. The precise number, types, and locations of the hydrants shall be determined during building permit review. Hydrants are to be a maximum of 400 feet apart. e. A minimum residual water pressure of 20 psi shall remain in the water system. Flow rates for public parking facilities shall be set at 1,000 to 1,500 gpm. 41 MM 5.12-9: Prior to issuance of the first building permit, the property owner/developer shall enter into an agreement recorded against the property with the City of Anaheim to pay or cause to be paid their fair share of the funding to accommodate the following, which will serve the Anaheim Resort Specific Plan area: a. One additional fire truck company. b. One additional paramedic company. c. Modifications to existing fire stations to accommodate the additional fire units, additional manpower, equipment and facilities. d. A vehicle equipped with specialty tools and equipment to enable the Fire Department to provide heavy search and rescue response capability. e. A medical triage vehicle/trailer, equipped with sufficient trauma dressings, medical supplies, stretchers, etc., to handle 1,000 injured persons, and an appropriate storage facility. The determination of the allocable share of costs attributable to the property owner/developer shall be based on an apportionment of the costs of such equipment/facilities among property owners/developers in the Hotel Circle Specific Plan Area, the Disneyland Resort Specific Plan Area and the Anaheim Resort Specific Plan Area or the otherwise defined service area, as applicable, depending on the area served. Note: To implement this mitigation measure, the City has adopted the Fire Protection Facilities and Paramedic Services Impact Fee Program. Compliance with this Program by the property owner/developer (per Ordinance No. 5496 and Resolution No. 95R-73 dated May 16, 1995) shall satisfy the requirements of this Mitigation Measure, or the City may enter into alternative financing arrangements. Fire -16- PC2016-*** NO. CONDITIONS OF APPROVAL RESPONSIBLE DEPARTMENT 42 MM 5.12-11: Prior to issuance of each building permit, the property owner/developer shall submit a Construction Fire Protection Plan to the Fire Department for review and approval detailing accessibility of emergency fire equipment, fire hydrant location, and any other construction features required by the Fire Marshal. The property owner/developer shall be responsible for securing facilities acceptable to the Fire Department and hydrants shall be operational with required fire flow. Fire 43 MM 5.12-14: Prior to approval of building plans, the property owner/developer shall provide written evidence to the satisfaction of the Fire Department that all lockable pedestrian and/or vehicular access gates shall be equipped with “knox box” devices as required and approved by the Fire Department. Fire 44 MM 5.12-17: Prior to issuance of each building permit, the property owner/developer shall provide proof of compliance with Government Code Section 53080 (Schools). Planning and Building 45 MM 5.12-19: Prior to the issuance of a building permit, the property owner/developer shall comply with the Anaheim Municipal Code, Section 17.08.385, Public Library Facilities Services Areas – Payment of Fees Required. Planning and Building 46 MM 5.14-2: Prior to issuance of the first building permit for each building, the property owner/developer shall pay the appropriate Traffic Signal Assessment Fees and Transportation Impact and Improvement Fees to the City of Anaheim in amounts determined by the City Council Resolution in effect at the time of issuance of the building permit with credit given for City-authorized improvements provided by the property owner/developer. The property owner shall also participate in all applicable reimbursement or benefit districts, which have been established. Public Works 47 MM 5.14-6: Prior to the issuance of each building permit for a hotel development that exceeds 100 rooms per gross acre within the Commercial Recreation (C-R) District (Development Area 1) within the Convention Center (CC) Medium density category, the property owner shall record a covenant on the property requiring that ongoing during project implementation, the property owner/developer shall implement TDM measures sufficient to reduce the actual trip generation from the development to no more than the trips assumed by the City’s traffic model. The form of the covenant shall be approved by the City Attorney’s Office. Public Works 48 MM 5.14-12: Prior to the issuance of the first building permit, the location of any proposed gates across a driveway shall be subject to the review and approval of the City Engineer. Gates shall not be installed across any driveway or private street in a manner which may adversely affect vehicular traffic on the adjacent public streets. Installation of any gates shall conform to the current version of Engineering Standard Detail No. 475. Public Works 49 MM 5.14-13: Prior to the issuance of building permits, plans shall show that all driveways shall be constructed with a minimum fifteen (15) foot radius curb returns as required by the City Engineer, unless otherwise approved by the City Engineer. Public Works 50 MM 5.15-2: Prior to issuance of each building permit, all water supply planning for the project will be closely coordinated with, and be subject to the review and final approval of, the Public Utilities Department, Water Engineering Division and Fire Department. Public Utilities -17- PC2016-*** NO. CONDITIONS OF APPROVAL RESPONSIBLE DEPARTMENT 51 MM 5.15-3: Prior to issuance of each building permit, water pressure greater than 80 pounds per square inch (psi) shall be reduced to 80 psi or less by means of pressure reducing valves installed at the property owner/developer’s service. Planning and Building 52 MM 5.15-4: Prior to the issuance of each building permit, the property owner/developer shall submit a landscape and irrigation plan which shall be prepared and certified by a licensed landscape architect. The irrigation plan shall specify methods for monitoring the irrigation system. The system shall ensure that irrigation rates do not exceed the infiltration of local soils, that the application of fertilizers and pesticides do not exceed appropriate levels of frequencies, and that surface runoff and overwatering is minimized. The landscaping and irrigation plans shall include water-conserving features such as low flow irrigation heads, automatic irrigation scheduling equipment, flow sensing controls, rain sensors, soil moisture sensors, and other water-conserving equipment. The landscaping and irrigation plans shall indicate that separate irrigation lines for recycled water shall be constructed and recycled water will be used when it becomes available. All irrigation systems shall be designed so that they will function properly with recycled water. Planning and Building 53 MM 5.15-6: Prior to issuance of each building permit, unless records indicate previous payment, the appropriate fees for Primary Mains, Secondary Mains and Fire Protection Service shall be paid to the Public Utilities Department, Water Engineering Division in accordance with Rule 15A, and Rule 20 of the Public Utilities Department Water Rates, Rules and Regulations. Public Utilities 54 MM 5.17-1: Prior to issuance of each building permit, the property owner/develop shall consult with the City of Anaheim Public Utilities Department, Business and Community Programs Division, in order to review energy efficient measures to incorporate into the project design. Prior to the final building and zoning inspection, the property owner developer shall implement these energy efficient measures which may include the following: a. High-efficiency air-conditioning systems with EMS (computer) control b. Variable air volume (VAV) distribution c. Outside air (100%) economizer cycle d. Staged compressors or variable speed drives to flow varying thermal loads e. Isolated HVAC zone control by floors/separable activity areas f. Specification of premium-efficiency electric motors (i.e., compressor motors, air-handling units, and fan-coil units) g. Use of occupancy sensors in appropriate spaces h. Use of compact fluorescent lamps i. Use of cold cathode fluorescent lamps j. Use of light emitting diode (LED) or equivalent energy-efficient lighting for outdoor lighting k. Use of Energy Star® exit lighting or exit signage. l. Use of T-8 lamps and electronic ballasts where applications of standard fluorescent fixtures are identified Public Utilities -18- PC2016-*** NO. CONDITIONS OF APPROVAL RESPONSIBLE DEPARTMENT m. Use of lighting power controllers in association with metal-halide or high- pressure sodium (high intensity discharge) lamps for outdoor lighting and parking lots n. Consideration of thermal energy storage air-conditioning for spaces or facilities that may require air-conditioning during summer, day-peak periods. o. For swimming pools and spas, incorporate solar heating, automatic covers, and efficient pumps and motors, as feasible. p. Consideration for participation in Advantage Services Programs such as: i. New construction design review, in which the City cost-shares engineering for up to $10,000 for design of energy efficient buildings and systems ii. New Construction – cash incentives ($300 to $400 per kW reduction in load) for efficiency that exceeds Title 24 requirements Green Building Program – offers accelerated plan approval, financial incentives, waived plan check fees and free technical assistance. 55 MM 5.17-3: Prior to issuance of each building permit, the property owner/developer shall submit plans and calculations to the City of Anaheim Planning and Building Department, Building Division, to demonstrate that the energy efficiency of each building will exceed the Title 24 Energy Efficiency Standards for Residential and Nonresidential Buildings current at the time of application by at least 10 percent. Planning and Building 56 MM 5.18-3: Prior to the issuance of building permits, the City shall require that building plans indicate that new developments will minimize stormwater and urban runoff into drainage facilities by incorporating design features such as detention basins, on-site water features, and other strategies. Public Works 57 MM 5.19-1: Prior to issuance of each building permit; to be implemented prior to final building and zoning Inspection, the property owner/developer shall submit project plans to the Public Works Department for review and approval to ensure that the plans comply with AB 939, the Solid Waste Reduction Act of 1989, as administered by the City of Anaheim and the County of Orange and City of Anaheim Integrated Waste Management Plans. Prior to final building and zoning inspection, implementation of said plan shall commence and shall remain in full effect. Waste management mitigation measures that shall be taken to reduce solid waste generation include, but are not limited to: a. Detailing the location and design of on-site recycling facilities. b. Providing on-site recycling receptacles to encourage recycling. c. Complying with all Federal, State and City regulation for hazardous material disposal. d. Participating in the City of Anaheim’s “Recycle Anaheim” program or other substitute program as may be developed by the City. In order to meet the requirements of the Solid Waste Reduction Act of 1989 (AB 939), the property owner/developer shall implement numerous solid waste reduction programs, as required by the Public Works Department, including, but not limited to: Public Works -19- PC2016-*** NO. CONDITIONS OF APPROVAL RESPONSIBLE DEPARTMENT a. Facilitating recycling by providing chutes or convenient locations for sorting and recycling bins. b. Facilitating cardboard recycling (especially in retail areas) by providing adequate space and centralized locations for collection and storing. c. Facilitating glass recycling (especially from restaurants) by providing adequate space for sorting and storing. d. Providing trash compactors for non-recyclable materials whenever feasible to reduce the total volume of solid waste and the number of trips required for collection. e. Prohibiting curbside pick-up. 58 MM 5.19-3: Prior to issuance of building permits, plans shall show that trash storage areas shall be provided and maintained in a location acceptable to the City of Anaheim Department of Public Works, Operations Division. On an ongoing basis, trash storage areas shall be provided and maintained in accordance with approved plans on file with said Department. Public Works 59 MM 5.19-4: Prior to issuance of each building permit, the Property Owner/Developer shall demonstrate that the plans include provisions for the installation of trash and recycle receptacles near all benches and near high traffic areas such as plazas, transit stops and retail and dining establishments. Public Works PRIOR TO APPROVAL OF WATER PLANS 60 MM 5.12-15: Prior to approval of on-site water plans, unless each commercial building is initially connected to separate fire services, an unsubordinated covenant satisfactory to the City Attorney’s Office shall be recorded prohibiting any individual sale of buildings until separate fire services are installed in the building(s) subject to the sale. Fire 61 MM 5.12-16: Prior to approval of water improvement plans, the water supply system shall be designed by the property owner/developer to provide sufficient fire flow pressure and storage for the proposed land use and fire protection services in accordance with Fire Department requirements. Fire ONGOING DURING CONSTRUCTION 62 MM 5.2-3: Ongoing during construction, the property owner/developer shall implement measures to reduce construction-related air quality impacts. These measures shall include, but are not limited to: a. Normal wetting procedures (at least twice daily) or other dust palliative measures shall be followed during earth-moving operations to minimize fugitive dust emissions, in compliance with the City of Anaheim Municipal Code including application of chemical soil stabilizers to exposed soils after grading is completed and replacing ground cover in disturbed areas as quickly as practicable. b. For projects where there is excavation for subterranean facilities (such as parking) on-site haul roads shall be watered at least every two hours or the on-site haul roads shall be paved. c. Enclosing, covering, watering twice daily, or applying approved soil binders, according to manufacturer’s specification, to exposed piles. Planning and Building -20- PC2016-*** NO. CONDITIONS OF APPROVAL RESPONSIBLE DEPARTMENT d. Roadways adjacent to the project shall be swept and cleared of any spilled export materials at least twice a day to assist in minimizing fugitive dust; and, haul routes shall be cleared as needed if spills of materials exported from the project site occur. e. Where practicable, heavy duty construction equipment shall be kept onsite when not in operation to minimize exhaust emissions associated with vehicles repetitiously entering and exiting the project site. f. Trucks importing or exporting soil material and/or debris shall be covered prior to entering public streets. g. Taking preventive measures to ensure that trucks do not carry dirt on tires onto public streets, including treating onsite roads and staging areas. h. Preventing trucks from idling for longer than 2 minutes. i. Manually irrigate or activate irrigation systems necessary to water and maintain the vegetation as soon as planting is completed. j. Reduce Traffic speeds on all unpaved road surfaces to 15 miles per hour or less. k. Suspend all grading operations when wind speeds (as instantaneous gust) exceed 25 miles per hour and during first and second stage smog alerts. l. Comply with SCAQMD Rule 402, which states that no dust impacts offsite are sufficient to be called a nuisance, and SCAQMD Rule 403, which restricts visible emissions from construction. m. Use low emission mobile construction equipment (e.g., tractors, scrapers, dozers, etc.) where practicable. n. Utilize existing power sources (e.g., power poles) or clean-fuel generators rather than temporary power generators, where practicable. o. Maintain construction equipment engines by keeping them properly tuned. p. Use low sulfur fuel for equipment, to the extent practicable. 63 MM 5.10-1: Ongoing during construction, the property owner/developer shall ensure that all internal combustion engines on construction equipment and trucks are fitted with properly maintained mufflers. Planning and Building 64 MM 5.10-6: Ongoing during construction and project operation, pressure washing operations for purposes of building repair and maintenance due to graffiti or other aesthetical considerations shall be limited to daytime hours of operation between 7:00 AM and 8:00 PM. Planning and Building 65 MM 5.10-7: Ongoing during construction and project operation, sweeping operations in the parking facilities and private on-site roadways shall be performed utilizing sweeping/scrubbing equipment which operate at a level measured not greater than 60 dBA at the nearest adjacent property line. Planning and Building 66 MM 5.14-7: Ongoing during construction, if the Anaheim Police Department or the Anaheim Traffic Management Center (TMC) personnel are required to provide temporary traffic control services, the property owner/developer shall reimburse the City, on a fair-share basis, if applicable, for reasonable costs associated with such services. Police Public Works -21- PC2016-*** NO. CONDITIONS OF APPROVAL RESPONSIBLE DEPARTMENT PRIOR TO EACH FINAL BUILDING AND ZONING INSPECTION 67 MM 5.1-5: Prior to final building and zoning inspections, private streets within the Anaheim Resort Specific Plan area shall have street lights installed which are compatible with the design standards used for the public streets as determined by the Public Utilities Department. Public Utilities 68 MM 5.1-6: Prior to final building and zoning inspections, root and sidewalk barriers shall be provided for trees within seven feet of public sidewalks. Planning and Building 69 MM 5.1-7 and 5.8-4: Prior to final building and zoning inspections, the property owner/developer shall submit to the Planning and Building Department a letter from a licensed landscape architect certifying that all landscaping and irrigation systems have been installed in accordance with landscaping plans approved in connection with the Final Site Plan. Planning and Building 70 MM 5.5-4: Prior to the final building and zoning inspection for a hotel/motel, the property owner/developer shall submit an earthquake emergency response plan for review and approval by the Fire Department. The plan shall require posted notices in all hotel rooms on earthquake safety procedures and incorporate ongoing earthquake training for hotel staff to the satisfaction of the Fire Department. Fire 71 MM 5.8-5: Prior to final building and zoning inspection, the property owner/developer shall install piping on-site with project water mains so that reclaimed water may be used for landscape irrigation, if and when it becomes available. Public Utilities 72 MM 5.12-10: Prior to each final building and zoning inspection, the property owner/developer shall place emergency telephone service numbers in prominent locations as approved by the Fire Department. Fire 73 MM 5.14-4: Prior to the final building and zoning inspection, the property owner shall join and financially participate in a clean fuel shuttle program such as the Anaheim Resort Transit system, and shall participate in the Anaheim Transportation Network in conjunction with the on-going operation of the project. The property owner shall also record a covenant on the property that requires participation in these programs ongoing during project operation. The form of the covenant shall be approved by the City Attorney’s Office prior to recordation. Public Works 74 MM 5.14-8: Prior to the final building and zoning inspection, the property owner shall record a covenant on the property requiring that ongoing during project implementation, the property owner/developer shall implement and administer a comprehensive Transportation Demand Management (TDM) program for all employees. The form of the covenant shall be approved by the City Attorney’s Office. Objectives of the TDM program shall be: a. Increase ridesharing and use of alternative transportation modes by guests. b. Provide a menu of commute alternatives for employees to reduce project- generated trips. c. Conduct an annual commuter survey to ascertain trip generation, trip origin, and Average Vehicle Ridership. Public Works 75 MM 5.14-9: Prior to the final building and zoning inspection, the property owner/developer shall provide to the City of Anaheim Public Works Department for review and approval a menu of TDM program strategies and elements for both existing and future employees’ commute options, and incentives for hotel patrons’ Public Works -22- PC2016-*** NO. CONDITIONS OF APPROVAL RESPONSIBLE DEPARTMENT transportation options. These options may include, but are not limited to, the list below. The property owner shall also record a covenant on the property requiring that the approved TDM strategies and elements be implemented ongoing during project operation. The form of the covenant shall be approved by the City Attorney’s Office prior to recordation. a. On-site services. Provide, as feasible and permitted, on-site services such as the food, retail, and other services. b. Ridesharing. Develop a commuter listing of all employee members for the purpose of providing a “matching” of employees with other employees who live in the same geographic areas and who could rideshare. c. Vanpooling. Develop a commuter listing of all employees for the purpose of matching numbers of employees who live in geographic proximity to one another and could comprise a vanpool or participate in the existing vanpool programs. d. Transit Pass. Promote Orange County Transportation Authority (including commuter rail) passes through financial assistance and on-site sales to encourage employees to use the various transit and bus services from throughout the region. e. Shuttle Service. Generate a commuter listing of all employees living in proximity to the project, and offer a local shuttle program to encourage employees to travel to work by means other than the automobile. When appropriate, event shuttle service shall also be made available for guests. f. Bicycling. Develop a Bicycling Program to offer a bicycling alternative to employees. Secure bicycle racks, lockers, and showers should be provided as part of this program. Maps of bicycle routes throughout the area should be provided to inform potential bicyclists of these options. g. Guaranteed Ride Home Program. Develop a program to provide employees who rideshare, or use transit or other means of commuting to work, with a prearranged ride home in a taxi, rental car, shuttle, or other vehicle, in the event of emergencies during the work shift. h. Target Reduction of Longest Commute Trip. Promote an incentive program for ridesharing and other alternative transportation modes to put highest priority on reduction of longest employee commute trips. i. Work Shifts. Stagger work shifts. j. Compressed Work Week. Develop a “compressed work week” program, which provides for fewer work days but longer daily shifts as an option for employees. k. Telecommuting. Explore the possibility of a “telecommuting” program that would link some employees via electronic means (e.g., computer with modem). l. Parking Management. Develop a parking management program that provides incentives to those who rideshare or use transit means other than single- occupant auto to travel to work. m. Access. Provide preferential access to high occupancy vehicles and shuttles. -23- PC2016-*** NO. CONDITIONS OF APPROVAL RESPONSIBLE DEPARTMENT n. Financial Incentive for Ridesharing and/or Public Transit. Offer employees financial incentives for ridesharing or using public transportation. Currently, federal law provides tax-free status for up to $65 per month per employee contributions to employees who vanpool or use public transit including commuter rail and/or express bus pools. o. Financial Incentive for Bicycling. Offer employees financial incentives for bicycling to work. p. Special “Premium” for the Participation and Promotion of Trip Reduction. Offer ticket/passes to special events, vacations, etc. to employees who recruit other employees for vanpool, carpool, or other trip reduction programs. q. Incentive Programs. Design incentive programs for carpooling and other alternative transportation modes so as to put highest priority on reduction of longest commute trips. 76 MM 5.14-21: Prior to the final building and zoning Inspection every property owner and/or lessee shall designate an on-site contact that will be responsible for coordinating with the ATN and implementing all trip mitigation measures. The on-site coordinator shall be the one point of contact representing the project with the ATN. The TDM requirements shall be included in the lease or other agreement with all of the project participants. Public Works 77 MM 5.15-7: Prior to final building and zoning inspections, a separate water meter shall be installed for landscape water on all projects where the landscape area exceeds 2,500 square feet in accordance with Ordinance No. 6160. Planning and Building 78 MM 5.17-2: Prior to final building and zoning inspection, the property owner/developer shall install an underground electrical service from the Public Utilities Distribution System. The Underground Service will be installed in accordance with the Electric Rules, Rates, Regulations and Electrical Specifications for Underground Systems. Electrical Service Fees and other applicable fees will be assessed in accordance with the Electric Rules, Rates, Regulations and Electrical Specifications for Underground Systems. Public Utilities ONGOING 79 MM 5.1-3: Ongoing, the property owner/developer shall be responsible for the removal of any on-site graffiti within 24 hours of its application. Planning and Building 80 MM 5.1-8: Ongoing, all on-site non-Public Realm landscaping and irrigation systems, and Public Realm landscaping and irrigation systems, within area in which dedication has not been accepted by the City, shall be maintained by the property owner/developer, in compliance with City standards. Planning and Building 81 MM 5.1-9: Ongoing, any tree planted within the Setback Realm shall be replaced in a timely manner in the event that it is removed, damaged, diseased and/or dead. Planning and Building 82 MM 5.1-10: Ongoing, a licensed arborist shall be hired by the property owner/developer to be responsible for all tree trimming. Planning and Building -24- PC2016-*** NO. CONDITIONS OF APPROVAL RESPONSIBLE DEPARTMENT 83 MM 5.2-1: Ongoing during project operation, the property owner/developer shall implement measures to reduce emissions to the extent practical, schedule goods movements for off-peak traffic hours, and use clean fuel for vehicles and other equipment, as practicable. Planning and Building 84 MM 5.8-3: Ongoing during project operations, the property owner/developer shall provide for the following: cleaning of all paved areas not maintained by the City of Anaheim on a monthly basis, including, but not limited to, private streets and parking lots. The use of water to clean streets, paved areas, parking lots, and other areas and flushing the debris and sediment down the storm drains shall be prohibited. Planning and Building 85 MM 5.12-3: Ongoing during project operation, the property owner/developer shall provide private security on the premises to maintain adequate security for the entire project subject to review and approval of the Police Department. The use of security patrols and electronic security devices (i.e., video monitors) should be considered to reduce the potential for criminal activity in the area. Police 86 MM 5.15-9: Ongoing, the City shall continue to collaborate with the Metropolitan Water District of Southern California (MWD), its member agencies, and the Orange County Water District (OCWD) to ensure that available water supplies meet anticipated demand. If it is forecasted that water demand exceeds available supplies, staff shall recommend to City Council to trigger application of the Water Conservation Ordinance (Anaheim Municipal Code, §10.18), as prescribed, to require mandatory conservation measures as authorized by Sections 10.18.070 through 10.18.090, as appropriate. Public Utilities 87 MM 5.19-2: Ongoing during project operation, the following practices shall be implemented, as feasible, by the property owner/developer: a. Usage of recycled paper products for stationary, letterhead, and packaging. b. Recovery of materials such as aluminum and cardboard. c. Collection of office paper for recycling. d. Collection of polystyrene (foam) cups for recycling. e. Collection of glass, plastics, kitchen grease, laser printer toner cartridges, oil, batteries, and scrap metal for recycling or recovery. Public Works City of Anaheim PLANNING AND BUILDING DEPARTMENT Planning Services Division 200 S. Anaheim Blvd. Anaheim, California 92805 TEL: 714.765.5139 FAX: 714.765.5280 To: File DEV2016-00038 From: Elaine Thienprasiddhi, Senior Planner Date: November 15, 2016 RE: Mitigation Monitoring Plan No. 337, Compliance with Measures Required Prior to Final Site Plan Approval Staff has verified that the applicant has complied with all mitigation measures that are required to be fulfilled prior to approval of the Final Site Plan, as follows: MM 5.12-12: Prior to the approval of each Final Site Plan and prior to the issuance of each building permit, plans shall be reviewed and approved by the Fire Department as being in conformance with the Uniform Fire Code. MM 5.1-14: Prior to Final Site Plan approval, plans shall show that no shuttle/bus/vehicular drop-off areas shall be permitted in hotel/motel or vacation resort front setback area. MM 5.1-13: Prior to Final Site Plan approval, plans shall show that the rear elevations of buildings visible from off-site areas shall be architecturally accented to portray a finished look. MM 5.1-4: Prior to Final Site Plan approval, the location and configuration of all lighting fixtures including ground-mounted lighting fixtures utilized to accent buildings, landscape elements, or to illuminate pedestrian areas shall be shown on all Final Site Plans. All proposed surface parking area lighting fixtures shall be down-lighted with a maximum height of 12 feet adjacent to any residential properties. All lighting fixtures shall be shielded to direct lighting toward the area to be illuminated and away from adjacent residential property lines. MM 5.1-1: Prior to final site plan approval, the property owner/developer shall submit a shade and shadow analysis to the Planning and Building Department for review and approval demonstrating that the proposed structure(s) would avoid creating significant shade and shadow impacts on adjacent land uses to the maximum extent feasible. A significant shade and shadow impact would occur when outdoor active areas (e.g., outdoor eating areas, hotel/motel swimming pools, and residential front and back yards) or structures that include sensitive uses (e.g., residences) have windows that normally receive sunlight are covered by shadows for more than 50 percent of the sunlight hours. ATTACHMENT NO. 3 File DEV2013-00138 November 25, 2015 Page 2 of 2 MM 5.10-2: Prior to approval of each final site plan, the property owner/developer shall submit a noise study prepared by a certified acoustical engineer to the satisfaction of the Building Division Manager identifying whether noise attenuation is required and defining the attenuation measures and specific performance requirements, if warranted, to comply with the Uniform Building Code and Sound Pressure Level Ordinance. Ultimate noise attenuation requirements, if any, shall depend on the final location of such buildings and noise-sensitive uses inside and surrounding the buildings. Attenuation measures shall be implemented by the property owner/developer prior to final building and zoning inspections. MM 5.4-3: Prior to approval of a final site plan for properties that contain a structure over 45 years old, property owners/developers shall submit to the Planning and Building Department, Planning Services Division, documentation to verify the presence/absence of historic resources. On properties where resources are identified, such documentation shall provide a detailed mitigation plan, including a monitoring program and recovery and/or in situ preservation plan, based on the recommendations of a qualified specialist. MM 5.12-1: Prior to the approval of each Final Site Plan and issuance of each building permit, the property owner/developer shall submit plans to the Police Department for review and approval for safety, accessibility, crime prevention, and security provisions during both the construction and operative phases for the purpose of incorporating safety measures in the project design including the concept of crime prevention through environmental design (e.g., building design, circulation, site planning, and lighting of parking structures and parking areas). MM 5.15-5: Prior to approval of the Final Site Plan and building permits, plans shall specifically show that the water meter and backflow equipment and any other large water system equipment will be installed to the satisfaction of the Public Utilities Department, Water Engineering Division, aboveground and behind the building setback line in a manner fully screened from all public streets and alleys and in accordance with Ordinance No. 4156. Prior to the final building and zoning inspections, the water meter and backflow equipment and any other large water system equipment shall be installed to the satisfaction of the Public Utilities Department, Water Engineering Division, in accordance with the Final Site Plan and the building permit plans. GRILL GRILL GRILL B.F . P . B.F.P . T T SITE PLAN1SCALE: 1" = 40'-0"0 20'40'80'NORTH 3B CIRCULATION PLAN PL A N N E D D E V E L O P M E N T P E R M I T CA M B R I A H O T E L & S U I T E S BY C H O I C E H O T E L S 10 1 E a s t K a t e l l a A v e n u e , A n a h e i m , C A , 9 2 8 0 2 ACRM PROJECT NO. 16-3302 ISSUED FOR: SHEET DATE: SHEET NO. APPLICANT HOTEL GROUP JULY 26, 2016DEVELOPMENT APPLICATION AWBREY COOK ROGERS MCGILL ARCHITECTS PROJECT CONSULTANT 1 MacArthur Place, Suite 300 Santa Ana, CA 92707 Ph: (714) 546-5600 Fx: (714) 546-5660 Phone: (619) 398-3480 1045 14th Avenue, Suite 100 San Diego, CA 92101-5701 AGENT THOMAS B. AWBREY, RA C17578 OCTOBER 3, 2016DEVELOPMENT APP. RE-SUBMITTAL OCTOBER 7, 2016SCHEMATIC DESIGN NOVEMBER 7, 2016DEVELOPMENT APP. RE-SUBMITTAL NOVEMBER 17, 2016DEVELOPMENT APP. RE-SUBMITTAL S O U T H M A N C H E S T E R A V E N U E EAST KATELLA AVENUE AN A H E I M B O U L E V A R D RESTAURANT 'B' 5% RAMP DOWN LOADING ZONE CAMBRIA HOTEL RESTAURANT 'C' RESTAURANT 'A' CL CL CL ST R E E T CE N T E R L I N E TR A S H CL CONTROL GATE PROFESSIONAL ENGINEERS, INC. E-Mail admin@tsqeng.com 1340 SPECIALTY DR. SUITE E TEL: (760) 560-0100 VISTA, CA 92081 FAX: (760) 560-0101 T-SQUARED www.tsqeng.com O N E W A Y BU S P A R K I N G BUS DROP OFF (PER #474) TRASH YARD 42' BUS TURNING RADIUS (WB-40) POOL EQUIPMENT SPORTS COURT SERVICE VEHICLES BUSES VEHICLES DIRECTIONAL SIGN TRAFFIC SIGNAL ARM CERCULATION LEGEND PEDESTRIANS EMERGENCY VEHICLES PL A N N E D D E V E L O P M E N T P E R M I T CA M B R I A H O T E L & S U I T E S BY C H O I C E H O T E L S 10 1 E a s t K a t e l l a A v e n u e , A n a h e i m , C A , 9 2 8 0 2 ACRM PROJECT NO. 16-3302 ISSUED FOR: SHEET DATE: SHEET NO. APPLICANT HOTEL GROUP JULY 26, 2016DEVELOPMENT APPLICATION AWBREY COOK ROGERS MCGILL ARCHITECTS PROJECT CONSULTANT 1 MacArthur Place, Suite 300 Santa Ana, CA 92707 Ph: (714) 546-5600 Fx: (714) 546-5660 Phone: (619) 398-3480 1045 14th Avenue, Suite 100 San Diego, CA 92101-5701 AGENT THOMAS B. AWBREY, RA C17578 OCTOBER 3, 2016DEVELOPMENT APP. RE-SUBMITTAL OCTOBER 7, 2016SCHEMATIC DESIGN NOVEMBER 7, 2016DEVELOPMENT APP. RE-SUBMITTAL NOVEMBER 17, 2016DEVELOPMENT APP. RE-SUBMITTAL 10 ELEVATIONS WEST ELEVATION3SCALE 1/16" = 1'-0" 0 8'16'32' SOUTH ELEVATION4SCALE 1/16" = 1'-0" 0 8'16'32' 0'-0" GROUND LEVEL 20'-0" 2ND FLOOR 29'-7 1/2" 3RD FLOOR 39'-3" 4TH FLOOR 48'-10 1/2" 5TH FLOOR 58'-6" 6TH FLOOR 68'-1 1/2" 7TH FLOOR 77'-9" 8TH FLOOR 87'-4 1/2" 9TH FLOOR 97'-0" 10TH FLOOR 106'-7 1/2" 11TH FLOOR 116'-3" 12TH FLOOR 125'-10 1/2" ROOF 135'-5" TOP OF PARAPET 0'-0" GROUND LEVEL 20'-0" 2ND FLOOR 29'-7 1/2" 3RD FLOOR 39'-3" 4TH FLOOR 48'-10 1/2" 5TH FLOOR 58'-6" 6TH FLOOR 68'-1 1/2" 7TH FLOOR 77'-9" 8TH FLOOR 87'-4 1/2" 9TH FLOOR 97'-0" 10TH FLOOR 106'-7 1/2" 11TH FLOOR 116'-3" 12TH FLOOR 125'-10 1/2" ROOF 135'-5" TOP OF PARAPET 141'-6 3/4" TOP OF PARAPET 130'-10 1/2" TOP OF EYEBROW 141'-6 3/4" 132'-5" TOP OF EYEBROW TOP OF EYEBROW 130'-10 1/2" TOP OF PARAPET 141'-6 3/4 " TOP OF PARAPET 137'-6 3/4 " TOP OF PARAPET BEYOND 137'-6 3/4" TOP OF PARAPET BEYOND 134'-3" TOP OF PARAPET BEYOND 137'-6 3/4" TOP OF EYEBROW BEYOND TOP OF PARAPET 137'-6 3/4" TOP OF PARAPET 20'-0" TOP OF PARAPET 20'-0" AUTOMATED SLIDING GLASS ENTRY DOOR PAINTED METAL GATE DECORATIVE EYEBROW ELEMENT CLAD WITH A HIGH PRESSURE LAMINATE PANELS 11 122 8 4 142 4 1 8 8 10 11 122 8 1 142 1 64 13 KEY MAP 3 N.T.S. 4 NOTE: ANY COLOR AND/OR MATERIAL CHANGES REQUIRE REVIEW BY THE PLANNING COMMISSION AS A REPORTS AND RECOMMENDATIONS ITEM PRELIMINARY EXTERIOR FINISH SCHEDULE NO.MATERIAL SPECS.COLOR GRAPHIC 1 PORCELAIN STONE CLADDING WALKER ZANGER NATURE COLLECTION HONEY BISQUE BROWN 2 1" CLEAR GLAZING T.B.D.T.B.D. 3 CORTEN STEEL PANELS WESTERN STATES METAL CORTEN A606-4 4 METAL CANOPY ATAS STEEL MEDIUM BRONZE 5 I BEAM CANOPY W/ WOOD UNDERSIDE T.B.D.T.B.D. 6 ALUMINUM LOUVERS T.B.D.T.B.D. 7 METAL PANEL SYSTEM ATAS STEEL BONE WHITE 8 EXT. CEMENT PLASTER SHERWIN WILLIAMS SW 7005 PURE WHITE 9 EXT. CEMENT PLASTER SHERWIN WILLIAMS SW 7696 TOASTED PINE NUT 10 HIGH PRESSURE LAMINATE PANELS TRESPA GOLD YELLOW 11 HIGH PRESSURE LAMINATE PANELS TRESPA SLATE GREY 12 ALUMINUM STOREFRONT SYSTEM KAWNEER BONE WHITE 13 PORCELAIN STONE CLADDING CROSSVILLE BLAX A1116 CABOOSE 14 ALUMINUM STOREFRONT SYSTEM KAWNEER MEDIUM BRONZE 15 PAINTED METAL CANOPY SHERWIN WILLIAMS SW 6258 TRICORN BLACK 6 9 6 PL A N N E D D E V E L O P M E N T P E R M I T CA M B R I A H O T E L & S U I T E S BY C H O I C E H O T E L S 10 1 E a s t K a t e l l a A v e n u e , A n a h e i m , C A , 9 2 8 0 2 ACRM PROJECT NO. 16-3302 ISSUED FOR: SHEET DATE: SHEET NO. APPLICANT HOTEL GROUP JULY 26, 2016DEVELOPMENT APPLICATION AWBREY COOK ROGERS MCGILL ARCHITECTS PROJECT CONSULTANT 1 MacArthur Place, Suite 300 Santa Ana, CA 92707 Ph: (714) 546-5600 Fx: (714) 546-5660 Phone: (619) 398-3480 1045 14th Avenue, Suite 100 San Diego, CA 92101-5701 AGENT THOMAS B. AWBREY, RA C17578 OCTOBER 3, 2016DEVELOPMENT APP. RE-SUBMITTAL OCTOBER 7, 2016SCHEMATIC DESIGN NOVEMBER 7, 2016DEVELOPMENT APP. RE-SUBMITTAL NOVEMBER 17, 2016DEVELOPMENT APP. RE-SUBMITTAL KEY MAP N.T.S. 11 RESTAURANT ELEVATIONS KEY MAP N.T.S. EAST KATELLA AVENUE AN A H E I M B O U L E V A R D 1 S O U T H M A N C H E S T E R A V E N U E 2 SOUTH RESTAURANT BUILDINGS ELEVATIONS1SCALE 1/16" = 1'-0" 0 8'16'32' 0'-0" GROUND LEVEL 38'-7" TOP OF ROOF 27'-0" TOP OF PARAPET NORTH RESTAURANT BUILDINGS ELEVATIONS2SCALE 1/16" = 1'-0" 0 8'16'32' 4 BUILDING 1 - EAST ELEVATION3SCALE 1/16" = 1'-0" 0 8'16'32' BUILDING 1 - WEST ELEVATION4SCALE 1/16" = 1'-0" 0 8'16'32' 3 6 5 8 7 BUILDING 2 - EAST ELEVATION5SCALE 1/16" = 1'-0" 0 8'16'32' BUILDING 2 - WEST ELEVATION6SCALE 1/16" = 1'-0" 0 8'16'32' BUILDING 3 - EAST ELEVATION7SCALE 1/16" = 1'-0" 0 8'16'32' BUILDING 3 - WEST ELEVATION8SCALE 1/16" = 1'-0" 0 8'16'32' 33'-0" TOP OF ROOF 0'-0" GROUND LEVEL 38'-7" TOP OF ROOF 27'-0" TOP OF PARAPET 33'-0" TOP OF ROOF NOTE: ANY COLOR AND/OR MATERIAL CHANGES REQUIRE REVIEW BY THE PLANNING COMMISSION AS A REPORTS AND RECOMMENDATIONS ITEM PRELIMINARY EXTERIOR FINISH SCHEDULE NO.MATERIAL SPECS.COLOR GRAPHIC 1 PORCELAIN STONE CLADDING WALKER ZANGER NATURE COLLECTION HONEY BISQUE BROWN 2 1" CLEAR GLAZING T.B.D.T.B.D. 3 CORTEN STEEL PANELS WESTERN STATES METAL CORTEN A606-4 4 METAL CANOPY ATAS STEEL MEDIUM BRONZE 5 I BEAM CANOPY W/ WOOD UNDERSIDE T.B.D.T.B.D. 6 ALUMINUM LOUVERS T.B.D.T.B.D. 7 METAL PANEL SYSTEM ATAS STEEL BONE WHITE 8 EXT. CEMENT PLASTER SHERWIN WILLIAMS SW 7005 PURE WHITE 9 EXT. CEMENT PLASTER SHERWIN WILLIAMS SW 7696 TOASTED PINE NUT 10 HIGH PRESSURE LAMINATE PANELS TRESPA GOLD YELLOW 11 HIGH PRESSURE LAMINATE PANELS TRESPA SLATE GREY 12 ALUMINUM STOREFRONT SYSTEM KAWNEER BONE WHITE 0'-0" GROUND LEVEL 38'-7" TOP OF ROOF 27'-0" TOP OF PARAPET 33'-0" TOP OF ROOF 0'-0" GROUND LEVEL 38'-7" TOP OF ROOF 27'-0" TOP OF PARAPET 33'-0" TOP OF ROOF 0'-0" GROUND LEVEL 38'-7" TOP OF ROOF 27'-0" TOP OF PARAPET 33'-0" TOP OF ROOF 13 PORCELAIN STONE CLADDING CROSSVILLE BLAX A1116 CABOOSE 5 7 6 15 1 3 14 14 ALUMINUM STOREFRONT SYSTEM KAWNEER MEDIUM BRONZE 2 6 17142FROSTED GLASS 6 17142FROSTED GLASS 1313 13 56142142167167142 15 PAINTED METAL CANOPY SHERWIN WILLIAMS SW 6258 TRICORN BLACK 15 15 151515 KATELL A A V E N U E A L D E N & S S O C I A T E S PLANNED DEVELOPMENT PERMIT CAMBRIA HOTEL & SUITES BY CHOICE HOTELS 101 East Katella Avenue, Anaheim, CA, 92802 P R O J E C T N O . 1 6 - 3 3 0 2 I S S U E D F O R : S H E E T D A T E : S H E E T N O . A P P L I C A N T H O T E L G R O U P AWBREY COOK ROGERS MCGILL ARCHITECTS P R O J E C T C O N S U L T A N T 1 M a c A r t h u r P l a c e , S u i t e 3 0 0 S a n t a A n a , C A 9 2 7 0 7 P h : ( 7 1 4 ) 5 4 6 - 5 6 0 0 F x : ( 7 1 4 ) 5 4 6 - 5 6 6 0 A G E N T J U L Y 2 6 , 2 0 1 6 D E V E L O P M E N T A P P L I C A T I O N O C T O B E R 3 , 2 0 1 6 D E V E L O P M E N T A P P . R E - S U B M I T T A L O C T O B E R 7 , 2 0 1 6 S C H E M A T I C D E S I G N P R E L I M I N A R Y G R A D I N G P L A N C . 1 KATELL A A V E N U E A L D E N & S S O C I A T E S PLANNED DEVELOPMENT PERMIT CAMBRIA HOTEL & SUITES BY CHOICE HOTELS 101 East Katella Avenue, Anaheim, CA, 92802 P R O J E C T N O . 1 6 - 3 3 0 2 I S S U E D F O R : S H E E T D A T E : S H E E T N O . A P P L I C A N T H O T E L G R O U P AWBREY COOK ROGERS MCGILL ARCHITECTS P R O J E C T C O N S U L T A N T 1 M a c A r t h u r P l a c e , S u i t e 3 0 0 S a n t a A n a , C A 9 2 7 0 7 P h : ( 7 1 4 ) 5 4 6 - 5 6 0 0 F x : ( 7 1 4 ) 5 4 6 - 5 6 6 0 A G E N T J U L Y 2 6 , 2 0 1 6 D E V E L O P M E N T A P P L I C A T I O N O C T O B E R 3 , 2 0 1 6 D E V E L O P M E N T A P P . R E - S U B M I T T A L O C T O B E R 7 , 2 0 1 6 S C H E M A T I C D E S I G N P R E L I M I N A R Y W E T U T I L I T Y P L A N C . 2 A L D E N & S S O C I A T E S PLANNED DEVELOPMENT PERMIT CAMBRIA HOTEL & SUITES BY CHOICE HOTELS 101 East Katella Avenue, Anaheim, CA, 92802 P R O J E C T N O . 1 6 - 3 3 0 2 I S S U E D F O R : S H E E T D A T E : S H E E T N O . A P P L I C A N T H O T E L G R O U P AWBREY COOK ROGERS MCGILL ARCHITECTS P R O J E C T C O N S U L T A N T 1 M a c A r t h u r P l a c e , S u i t e 3 0 0 S a n t a A n a , C A 9 2 7 0 7 P h : ( 7 1 4 ) 5 4 6 - 5 6 0 0 F x : ( 7 1 4 ) 5 4 6 - 5 6 6 0 A G E N T J U L Y 2 6 , 2 0 1 6 D E V E L O P M E N T A P P L I C A T I O N O C T O B E R 3 , 2 0 1 6 D E V E L O P M E N T A P P . R E - S U B M I T T A L O C T O B E R 7 , 2 0 1 6 S C H E M A T I C D E S I G N C R O S S S E C T I O N S C . 3 B.F.P. B. F . P . T T CAMBRIAHOTELANAHEIM BOULEVARDEAST KATELLA AVENUE SERVICE M A N C H E S T E R B O U L E V A R D (E)(E)(E)(E)(E)(E)(E)(E)(E)(E)(E)(E)(E)(E)(E)(E)(E)(E)(E) ( E ) ( E ) ( E ) ( E ) ( E ) ( E ) ( E ) ( E ) ( E ) ( E ) ( E ) ( E ) ( E ) ( E ) ( E ) ( E ) ( E ) (E)(E)(E)(E)(E)(E)(E)(E)(E)(E) R E M O V E A N D R E L O C A T E ( 1 ) D A T E P A L M R E M O V E A N D D I S P O S E O F ( 1 ) T I P U R E M O V E A N D R E L O C A T E ( 1 ) W A S H I N G T O N I A P A L M * * * * * * * * * * * S E T B A C K L I N E (E) * * * * * * AL6.1 BL6.1 C L 6 . 1 AL2.1 P L A N T P A L E T T E S Y M B O L B O T A N I C A L N A M E C O M M O N N A M E S I Z E S P A C I N G W A T E R U S E C O M M E N T S A R S P P L A N T S E X I S T I N G T R E E S P H O E N I X D A C T Y L I F E R A D A T E P A L M 2 4 " D I A . T R U N K - - L O W K A T E L L A A V E N U E S T R E E T T R E E Ɣ T I P U A N A T I P U T I P U T R E E 1 2 " D I A . T R U N K L O W M A N C H E S T E R S T R E E T T R E E Ɣ C A S S I A L E P T O P H Y L L A G O L D M E D A L L I O N T R E E 8 " D I A . T R U N K M O D H A S T E R S T R E E T / A N A H E I M B L V D . @ B U S S T O P Ɣ W A S H I N G T O N I A R O B U S T A M E X I C A N F A N P A L M 1 2 " D I A . T R U N K L O W H A S T E R S T R E E T / A N A H E I M B L V D . & M A N C H E S T E R Ɣ P R O P O S E D T R E E S L O P H O S T E M O N C O N F E R T U S - O R - B R I S B A N E B O X 2 4 " B O X - - M O D Ɣ P O D O C A R P U S G R A C I L I O R F E R N P I N E L A G E R S T R O E M I A I N D I C A O R M E T R O S I D E R O S E X C E L S A C R A P E M Y R T L E O R N E W Z E A L A N D C H R I S T M A S T R E E 2 4 " B O X - - M O D Ɣ C A S S I A L E P T O P H Y L L A G O L D M E D A L L I O N T R E E 2 4 " B O X - - M O D Ɣ P H O E N I X D A C T Y L I F E R A D A T E P A L M 1 8 ' B T H L O W Ɣ W A S H I N G T O N I A F I L A B U S T A H Y B R I D W A S H I N G T O N I A P A L M 2 0 ' B T H M I N . L O W Ɣ S H R U B S A N D G R O U N D C O V E R S C A L L I S T E M O N ' L I T T L E J O H N ' D W A R F B O T T L E B R U S H 5 G A L . 3 0 " O . C . L O W Ɣ C A R I S S A M . ' G R E E N C A R P E T ' D W A R F N A T A L P L U M 5 G A L . 3 6 " O . C . M O D H E M E R O C A L L L I S H Y B R I D D A Y L I L Y 1 G A L . 2 4 " O . C . M O D L A N T A N A ' N E W G O L D ' N E W G O L D L A N T A N A 5 G A L . 3 6 " O . C . L O W L I G U S T R U M J . ' T E X A N U M ' T E X A S P R I V E T 5 G A L . 3 0 " O . C . M O D Ɣ P H I L O D E N D R O N ' X A N A D U ' X A N A D U P H I L O D E N D R O N 5 G A L . 3 6 " O . C . M O D Ɣ P H O R M I U M T . ' D A Z Z L E R ' D A Z Z L E R N E W Z E A L A N D F L A X 5 G A L . 3 6 " O . C . M O D Ɣ P H O R M I U M T . ' J A C K S P R A T T ' D W A R F N E W Z E A L A N D F L A X 5 G A L . 2 4 " O . C . M O D Ɣ R O S M A R I N U S O . ' P R O S T R A T U S ' P R O S T R A T E R O S E M A R Y F L A T S 1 2 " O . C . L O W Ɣ S T R E L I T Z I A N I C O L A I G I A N T B I R D O F P A R A D I S E 5 G A L . 4 8 " O . C . M O D Ɣ S T R E L I T Z I A R E G I N A E B I R D O F P A R A D I S E 5 G A L . 3 6 " O . C . M O D Ɣ S Y N T H E T I C T U R F P U T T I N G G R E E N - - - - - - Ɣ L I G U S T R U M J A P O N I C U M ' T E X A N U M ' W A X - L E A F P R I V E T 1 5 G A L . 3 0 " O . C . H I G H T O T A L : 8 1 % ( E ) ( E ) ( E ) ( E ) N O T E : E X I S T I N G T R E E S A N D P A L M S T O B E R E M O V E D A N D / O R R E L O C A T E D N O T E D O N P L A N . PLANNED DEVELOPMENT PERMIT CAMBRIA HOTEL & SUITES BY CHOICE HOTELS 101 East Katella Avenue, Anaheim, CA, 92802 A P P L I C A N T H O T E L G R O U P AWBREY COOK ROGERS MCGILL ARCHITECTS P R O J E C T C O N S U L T A N T 1 M a c A r t h u r P l a c e , S u i t e 3 0 0 S a n t a A n a , C A 9 2 7 0 7 P h : ( 7 1 4 ) 5 4 6 - 5 6 0 0 F x : ( 7 1 4 ) 5 4 6 - 5 6 6 0 A C R M P R O J E C T N O . 1 6 - 3 3 0 2 I S S U E D F O R : D A T E : J U L Y 2 6 , 2 0 1 6 D E V E L O P M E N T A P P L I C A T I O N A G E N T O C T . 0 3 , 2 0 1 6 D E V E L O P M E N T A P P . R E - S U B M I T T A L S H E E T S H E E T N O . N O V . 0 7 , 2 0 1 6 D E V E L O P M E N T A P P . R E - S U B M I T T A L N O T E S : A . T O T A L L A N D S C A P E A R E A ( I N C L U D I N G P O O L S A N D W A T E R F E A T U R E S ) F O R P R O J E C T I S 7 6 , 6 6 3 S Q . F T . P R O P O S E D L A N D S C A P E A N D I R R I G A T I O N W I L L C O M P L Y W I T H C H A P T E R 1 0 . 1 9 O F T H E A N A H E I M M U N I C I P A L C O D E A N D O R D I N A N C E N o . 6 3 5 5 R E L A T I N G T O L A N D S C A P E W A T E R E F F I C I E N C Y . B . A S E P A R A T E D E D I C A T E D W A T E R M E T E R W I L L B E P R O V I D E D F O R L A N D S C A P E I R R I G A T I O N U S E . C . L A N D S C A P E S C R E E N I N G W I L L B E P R O V I D E D A R O U N D T R A N S F O R M E R S , B A C K F L O W P R E V E N T E R S , A N D O T H E R W A T E R A S S E M B L I E S I N A C C O R D A N C E W I T H R E Q U I R E M E N T S O F O R D I N A N C E N o . 5 1 5 6 A N D C H A P T E R 1 8 . 4 6 O F T H E A N A H E I M M U N I C I P A L C O D E . D . A L L A B O V E G R A D E E Q U I P M E N T W I L L B E L O C A T E D B E H I N D T H E B U I L D I N G S E T B A C K L I N E A N D S C R E E N E D I N A C C O R D A N C E W I T H A N A H E I M M U N I C I P A L C O D E S E C T I O N 1 8 . 3 8 . 1 6 0 . E . R E F E R T O T E C H N I C A L P L A N ( L 3 . 1 ) F O R S T R E E T S C A P E S E C T I O N S , R E F E R T O S H E E T L 6 . 1 P L A N T P A L E T T E S Y M B O L B O T A N I C A L N A M E C O M M O N N A M E E X I S T I N G T R E E S P H O E N I X D A C T Y L I F E R A D A T E P A L M T I P U A N A T I P U T I P U T R E E C A S S I A L E P T O P H Y L L A G O L D M E D A L L I O N T R E E W A S H I N G T O N I A R O B U S T A M E X I C A N F A N P A L M P R O P O S E D T R E E S L O P H O S T E M O N C O N F E R T U S - O R - B R I S B A N E B O X P O D O C A R P U S G R A C I L I O R F E R N P I N E L A G E R S T R O E M I A I N D I C A O R M E T R O S I D E R O S E X C E L S A C R A P E M Y R T L E O R N E W Z E A L A N D C H R I S T M A S T R E E C A S S I A L E P T O P H Y L L A G O L D M E D A L L I O N T R E E P H O E N I X D A C T Y L I F E R A D A T E P A L M W A S H I N G T O N I A F I L A B U S T A H Y B R I D W A S H I N G T O N I A P A L M ( E ) ( E ) ( E ) ( E ) N O T E : E X I S T I N G T R E E S A N D P A L M S T O B E R E M O V E D A N D / O R R E L O C A T E D N O T E D O N P L A N . ANAHEIM BOULEVARD S O U T H M A N C H E S T E R A V E N U E (E)(E)(E)(E) ( E ) ( E ) ( E ) ( E ) ( E ) ( E ) BL6.1 AL2.1ANAHEIMPARKWAYWALKLANDSCAPESETBACKRESTROOMSWADINGDECK P O O L W A D I N G D E C K P A D E C K B B Q A R E A L A N D S C A P E S E T B A C K P A R K W A Y M A N C H E S T E R 8' TALL MOVIE WALL 8 ' T A L L S C R E E N W A L L S I G H T L I N E PLANNED DEVELOPMENT PERMIT CAMBRIA HOTEL & SUITES BY CHOICE HOTELS 101 East Katella Avenue, Anaheim, CA, 92802 A P P L I C A N T H O T E L G R O U P AWBREY COOK ROGERS MCGILL ARCHITECTS P R O J E C T C O N S U L T A N T 1 M a c A r t h u r P l a c e , S u i t e 3 0 0 S a n t a A n a , C A 9 2 7 0 7 P h : ( 7 1 4 ) 5 4 6 - 5 6 0 0 F x : ( 7 1 4 ) 5 4 6 - 5 6 6 0 A C R M P R O J E C T N O . 1 6 - 3 3 0 2 I S S U E D F O R : D A T E : J U L Y 2 6 , 2 0 1 6 D E V E L O P M E N T A P P L I C A T I O N A G E N T O C T . 0 3 , 2 0 1 6 D E V E L O P M E N T A P P . R E - S U B M I T T A L S H E E T S H E E T N O . N O V . 0 7 , 2 0 1 6 D E V E L O P M E N T A P P . R E - S U B M I T T A L 1 L E G E N D D U A L W A T E R S L I D E 0 " E D G E W A D I N G P O O L P O P U P J E T S W A T E R P L A Y 2 5 ' X 6 0 ' P O O L 8 ' X 1 5 ' S P A T O W E L D I S P E N S A R Y P U T T I N G G R E E N B B Q C E N T E R F I R E P I T M O V I E W A L L 2 5 ' X 3 0 ' S P O R T C O U R T 8 ' H I G H P E R I M E T E R F E N C E R E S T A U R A N T P A T I O C A B A N A S 8 ' H T . C M U W A L L W I T H P L A S T E R F I N I S H T O M A T C H A R C H I T E C T U R E 2 3 4 5 6 7 8 9 1 0 1 1 1 2 1 3 1 4 1 2 345 6 7 8 9 1 1 12 13 14 1 4 1 5 1 5 10 3 1 5 N O T E S : A . P O O L S , S P A S , A N D W A T E R P L A Y A R E A S W I L L B E O N A R E - C I R C U L A T I N G S Y S T E M . SECTION A: LINE OF SIGHT SECTION AT POOL, SPA, AND MOVIE WAL L B.F.P. B. F . P . T T CAMBRIAHOTELANAHEIM BOULEVARDEAST KATELLA AVENU E SERVICE M A N C H E S T E R B O U L E V A R D (E)(E)(E)(E)(E)(E)(E)(E)(E)(E)(E)(E)(E)(E)(E)(E)(E)(E)(E) ( E ) ( E ) ( E ) ( E ) ( E ) ( E ) ( E ) ( E ) ( E ) ( E ) ( E ) ( E ) ( E ) ( E ) ( E ) ( E ) ( E ) ( E ) ( E ) ( E ) (E)(E)(E)(E)(E)(E)(E) * * * * * * * * * * * ( E ) * * * * * * L A N D S C A P E S E T B A C K Z O N E LANDSCAPESETBACK ZONE S E E E N L A R G E M E N T E , S H E E T L 4 . 1 SEE ENLARGEMENT D,SHEET L4.1 SEE ENLARGEMENTC, SHEET L4.1SEE ENLARGEMENTB, SHEET L4.1 S E E E N L A R G E M E N T F , S H E E T L 4 . 1 SEE ENLARGEMENT A,SHEET L4.1 L A N D S C A P E S E T B A C K Z O N E ( 2 ) F L U C H 5 ' x 5 ' E L E C T R I C A L V A U L T S S C R E E N I N G V I N E S A T W A L L SCREENING VINESAT WALLSCREENING VINESAT WALLSCREENING VINES ATWALL S C R E E N I N G H E D G E A T F I R E & D O M E S T I C W A T E R B A C K F L O W S C R E E N I N G H E D G E A T F I R E & D O M E S T I C W A T E R B A C K F L O W SCREENING HEDGE ATFIRE & DOMESTIC WATERBACKFLOWAL6.1 BL6.1 C L 6 . 1 AL2.1 L A N D S C A P E P L A N T I N G D E S I G N C O M P L I E S W I T H T H E A N A H E I M R E S O R T S P E C I F I C P L A N T R E E D E N S I T Y C A L C U L A T I O N S F O R S E T B A C K R E A L M L A N D S C A P E M O D E R A T E L Y D E N S E T R E E S R E Q U I R E D A L O N G K A T E L L A I N S E T B A C K R E A L M L A N D S C A P E 0 . 3 0 . 5 K A T E L L A A V E N U E 7 , 2 2 8 S . F . L A N D S C A P E A R E A ( 9 ) 1 8 ' B T H P H O E N I X P A L M = 2 , 7 0 0 P O I N T S ( 6 ) 2 4 " B O X T R E E S = 3 0 0 P O I N T S T R E E D E N S I T Y : 3 , 0 0 0 / 7 , 2 2 8 = 0 . 4 2 T R E E D E N S I T Y M O D E R A T E L Y D E N S E T R E E S R E Q U I R E D A L O N G A N A H E I M B O U L E V A R D I N S E T B A C K R E A L M L A N D S C A P E 0 . 3 0 . 5 A N A H E I M B O U L E V A R D 1 2 , 0 1 6 S . F . L A N D S C A P E A R E A ( 2 3 ) 2 4 " B O X T R E E S = 1 , 1 5 0 P O I N T S ( 7 ) 1 8 ' B T H P H O E N I X P A L M = 2 , 1 0 0 P O I N T S ( 2 3 ) 2 0 ' B T H W A S H I N G T O N I A P A L M = 2 , 8 7 5 P O I N T S T R E E D E N S I T Y : 5 , 4 7 5 / 1 2 , 0 1 6 = 0 . 5 0 T R E E D E N S I T Y M O D E R A T E L Y D E N S E T R E E S R E Q U I R E D A L O N G M A N C H E S T E R A V E N U E I N S E T B A C K R E A L M L A N D S C A P E 0 . 3 0 . 5 M A N C H E S T E R A V E N U E 1 6 , 0 4 3 S . F . L A N D S C A P E A R E A ( 2 8 ) 2 4 " B O X T R E E S = 1 , 4 0 0 P O I N T S ( 5 ) 1 8 ' B T H P H O E N I X P A L M = 1 , 5 0 0 P O I N T S ( 2 5 ) 2 0 ' B T H W A S H I N G T O N I A P A L M = 3 , 1 2 5 P O I N T S T R E E D E N S I T Y : 5 , 5 5 0 / 1 5 , 9 4 5 = 0 . 3 7 T R E E D E N S I T Y P A R K I N G L O T L A N D S C A P E T A B U L A T I O N S ( 1 ) T R E E A N D L A N D S C A P E P L A N T E R F O R E V E R Y ( 5 ) P A R K I N G S P A C E S A T G R A D E : N O . O N - G R A D E P A R K I N G S P A C E S = 7 8 E A C H P A R K I N G L O T T R E E S R E Q U I R E D = 1 6 P A R K I N G L O T T R E E S P R O V I D E D = 1 7 P A R K I N G L O T T R E E * PLANNED DEVELOPMENT PERMIT CAMBRIA HOTEL & SUITES BY CHOICE HOTELS 101 East Katella Avenue, Anaheim, CA, 92802 A P P L I C A N T H O T E L G R O U P AWBREY COOK ROGERS MCGILL ARCHITECTS P R O J E C T C O N S U L T A N T 1 M a c A r t h u r P l a c e , S u i t e 3 0 0 S a n t a A n a , C A 9 2 7 0 7 P h : ( 7 1 4 ) 5 4 6 - 5 6 0 0 F x : ( 7 1 4 ) 5 4 6 - 5 6 6 0 A C R M P R O J E C T N O . 1 6 - 3 3 0 2 I S S U E D F O R : D A T E : J U L Y 2 6 , 2 0 1 6 D E V E L O P M E N T A P P L I C A T I O N A G E N T O C T . 0 3 , 2 0 1 6 D E V E L O P M E N T A P P . R E - S U B M I T T A L S H E E T S H E E T N O . N O V . 0 7 , 2 0 1 6 D E V E L O P M E N T A P P . R E - S U B M I T T A L F O R S T R E E T S C A P E S E C T I O N S , R E F E R T O S H E E T L 6 . 1 1 L E G E N D T U B U L A R S T E E L F E N C E ( S E E P A G E L 7 . 1 ) F R E E S T A N D I N G P L A S T E R W A L L W I T H C O N C R E T E C A P ( S E E P A G E L 7 . 1 ) 2 2 1 W A T E R C O N S E R V A T I O N N O T E S T H E F O L L O W I N G W A T E R C O N S E R V A T I O N T E C H N I Q U E S S H A L L B E E M P L O Y E D I N T H I S P R O J E C T : A . W A T E R C O N S E R V I N G P L A N T S A N D P L A N T S N A T I V E T O H O T , D R Y S U M M E R S T O B E U T I L I Z E D I N 7 5 % O F T H E T O T A L P L A N T E D A R E A . B . U S E O F H Y D R O Z O N E S W I T H P L A N T S G R O U P E D B A S E D U P O N A M O U N T O F W A T E R N E E D E D T O S U S T A I N T H E M . C . M U L C H 3 / 4 " - 1 " S I Z E U T I L I Z E D I N T H E L A N D S C A P E ; 3 " D E P T H M I N I M U M . D . S O I L A M E N D M E N T S U T I L I Z E D T O I M P R O V E W A T E R H O L D I N G C A P A C I T Y O F S O I L . E . A U T O M A T I C I R R I G A T I O N S Y S T E M A D J U S T E D S E A S O N A L L Y A N D W I T H W A T E R I N G H O U R S B E T W E E N 1 0 : 0 0 P . M . A N D 6 : 0 0 A . M . F . I R R I G A T I O N S Y S T E M D E S I G N E D T O W A T E R D I F F E R E N T A R E A S O F T H E L A N D S C A P E B A S E D O N W A T E R I N G N E E D . G . I R R I G A T I O N D E S I G N S E N S I T I V E T O S L O P E F A C T O R S . H . R A I N S E N S O R S U S E D I N C O N J U N C T I O N W I T H T H E A U T O M A T I C I R R I G A T I O N S Y S T E M . I . R E C O M M E N D A T I O N S G I V E N F O R A N N U A L I R R I G A T I O N S C H E D U L E . J . L A N D S C A P E W A T E R U S E C E R T I F I C A T I O N W I T H S U P P O R T I N G D A T A I N C O M P L I A N C E W I T H S T A T E O F C A L I F O R N I A W A T E R E F F I C I E N C Y O R D I N A N C E F O R A P P R O V A L S H A L L B E S U B M I T T E D W I T H L A N D S C A P E C O N S T R U C T I O N D O C U M E N T S U B M I T T A L T O T H E O W N E R . A B 1 8 8 1 W A T E R B U D G E T C A L C U L A T I O N S ( C A L C U L A T I O N S S H O W T H I S P R O J E C T T O B E I N C O M P L I A N C E W I T H S T A T E W A T E R O R D I N A N C E A B 1 8 8 1 ) I R R I G A T I O N N O T E : I R R I G A T I O N E Q U I P M E N T S H A L L B E P E R T H E A P P R O V E D A R M D L A N D S C A P E A N D I R R I G A T I O N E Q U I P M E N T L I S T . S P R A Y H E A D S S H A L L B E R A I N B I R D 1 8 1 2 S A M W I T H T O R O P R E C I S I O N S P R A Y N O Z Z L E S . A D D I T I O N A L N O T E S : A . T O T A L L A N D S C A P E A R E A ( I N C L U D I N G P O O L S A N D W A T E R F E A T U R E S ) F O R P R O J E C T I S 7 6 , 6 6 3 S Q . F T . P R O P O S E D L A N D S C A P E A N D I R R I G A T I O N W I L L C O M P L Y W I T H C H A P T E R 1 0 . 1 9 O F T H E A N A H E I M M U N I C I P A L C O D E A N D O R D I N A N C E N o . 6 3 5 5 R E L A T I N G T O L A N D S C A P E W A T E R E F F I C I E N C Y . B . A S E P A R A T E D E D I C A T E D W A T E R M E T E R W I L L B E P R O V I D E D F O R L A N D S C A P E I R R I G A T I O N U S E . C . L A N D S C A P E S C R E E N I N G W I L L B E P R O V I D E D A R O U N D T R A N S F O R M E R S , B A C K F L O W P R E V E N T E R S , A N D O T H E R W A T E R A S S E M B L I E S I N A C C O R D A N C E W I T H R E Q U I R E M E N T S O F O R D I N A N C E N o . 5 1 5 6 A N D C H A P T E R 1 8 . 4 6 O F T H E A N A H E I M M U N I C I P A L C O D E . D . A L L A B O V E G R A D E E Q U I P M E N T W I L L B E L O C A T E D B E H I N D T H E B U I L D I N G S E T B A C K L I N E A N D S C R E E N E D I N A C C O R D A N C E W I T H A N A H E I M M U N I C I P A L C O D E S E C T I O N 1 8 . 3 8 . 1 6 0 . SCREENING VINES AT WALL P L A N T P A L E T T E S Y M B O L B O T A N I C A L N A M E C O M M O N N A M E S I Z E S P A C I N G W A T E R U S E C O M M E N T S A R S P P L A N T S E X I S T I N G T R E E S P H O E N I X D A C T Y L I F E R A D A T E P A L M 2 4 " D I A . T R U N K - - L O W K A T E L L A A V E N U E S T R E E T T R E E Ɣ T I P U A N A T I P U T I P U T R E E 1 2 " D I A . T R U N K L O W M A N C H E S T E R S T R E E T T R E E Ɣ C A S S I A L E P T O P H Y L L A G O L D M E D A L L I O N T R E E 8 " D I A . T R U N K M O D H A S T E R S T R E E T / A N A H E I M B L V D . @ B U S S T O P Ɣ W A S H I N G T O N I A R O B U S T A M E X I C A N F A N P A L M 1 2 " D I A . T R U N K L O W H A S T E R S T R E E T / A N A H E I M B L V D . & M A N C H E S T E R Ɣ P R O P O S E D T R E E S L O P H O S T E M O N C O N F E R T U S - O R - B R I S B A N E B O X 2 4 " B O X - - M O D Ɣ P O D O C A R P U S G R A C I L I O R F E R N P I N E L A G E R S T R O E M I A I N D I C A O R M E T R O S I D E R O S E X C E L S A C R A P E M Y R T L E O R N E W Z E A L A N D C H R I S T M A S T R E E 2 4 " B O X - - M O D Ɣ C A S S I A L E P T O P H Y L L A G O L D M E D A L L I O N T R E E 2 4 " B O X - - M O D Ɣ P H O E N I X D A C T Y L I F E R A D A T E P A L M 1 8 ' B T H L O W Ɣ W A S H I N G T O N I A F I L A B U S T A H Y B R I D W A S H I N G T O N I A P A L M 2 0 ' B T H M I N . L O W Ɣ S H R U B S A N D G R O U N D C O V E R S A G A P A N T H U S ' Q U E E N A N N E ' C A L L I S T E M O N ' L I T T L E J O H N ' D W A R F B O T T L E B R U S H 5 G A L . 3 0 " O . C . L O W Ɣ C A R I S S A M . ' G R E E N C A R P E T ' D W A R F N A T A L P L U M 5 G A L . 3 6 " O . C . M O D H E M E R O C A L L L I S H Y B R I D D A Y L I L Y 1 G A L . 2 4 " O . C . M O D L A N T A N A ' N E W G O L D ' N E W G O L D L A N T A N A 5 G A L . 3 6 " O . C . L O W L I G U S T R U M J . ' T E X A N U M ' T E X A S P R I V E T 5 G A L . 3 0 " O . C . M O D Ɣ P H I L O D E N D R O N ' X A N A D U ' X A N A D U P H I L O D E N D R O N 5 G A L . 3 6 " O . C . M O D Ɣ P H O R M I U M T . ' D A Z Z L E R ' D A Z Z L E R N E W Z E A L A N D F L A X 5 G A L . 3 6 " O . C . M O D Ɣ P H O R M I U M T . ' J A C K S P R A T T ' D W A R F N E W Z E A L A N D F L A X 5 G A L . 2 4 " O . C . M O D Ɣ R H A P H I O L E P I S ' I N D I A N H A W T H O R N ' R O S M A R I N U S O . ' P R O S T R A T U S ' P R O S T R A T E R O S E M A R Y F L A T S 1 2 " O . C . L O W Ɣ S T R E L I T Z I A N I C O L A I G I A N T B I R D O F P A R A D I S E 5 G A L . 4 8 " O . C . M O D Ɣ S T R E L I T Z I A R E G I N A E B I R D O F P A R A D I S E 5 G A L . 3 6 " O . C . M O D Ɣ S Y N T H E T I C T U R F P U T T I N G G R E E N - - - - - - Ɣ L I G U S T R U M J A P O N I C U M ' T E X A N U M ' W A X - L E A F P R I V E T 1 5 G A L . 3 0 " O . C . H I G H T R A C H E L O S P E R M U M ' S T A R J A S M I N E ' P E R C E N T A G E O F A R S P A P P R O V E D P L A N T M A T E R I A L T O T A L : 8 1 % ( E ) ( E ) ( E ) ( E ) N O T E : E X I S T I N G T R E E S A N D P A L M S T O B E R E M O V E D A N D / O R R E L O C A T E D N O T E D O N P L A N . PLANNED DEVELOPMENT PERMIT CAMBRIA HOTEL & SUITES BY CHOICE HOTELS 101 East Katella Avenue, Anaheim, CA, 92802 A P P L I C A N T H O T E L G R O U P AWBREY COOK ROGERS MCGILL ARCHITECTS P R O J E C T C O N S U L T A N T 1 M a c A r t h u r P l a c e , S u i t e 3 0 0 S a n t a A n a , C A 9 2 7 0 7 P h : ( 7 1 4 ) 5 4 6 - 5 6 0 0 F x : ( 7 1 4 ) 5 4 6 - 5 6 6 0 A C R M P R O J E C T N O . 1 6 - 3 3 0 2 I S S U E D F O R : D A T E : J U L Y 2 6 , 2 0 1 6 D E V E L O P M E N T A P P L I C A T I O N A G E N T O C T . 0 3 , 2 0 1 6 D E V E L O P M E N T A P P . R E - S U B M I T T A L S H E E T S H E E T N O . N O V . 0 7 , 2 0 1 6 D E V E L O P M E N T A P P . R E - S U B M I T T A L N O T T O S C A L E K E Y M A P ANAHEIM B O U L E V A R D S O U T H M A N C H E S T E R A V E N U E E A S T K A T E L L A A V E N U E A B C D E F ENLARGEMENT E1"=20'ENLARGEMENT F1"=20'ENLARGEMENT C1" = 2 0 ' ENLARGEMENT D 1 " = 2 0 ' E N L A R G E M E N T A 1 " = 2 0 ' E N L A R G E M E N T B 1 " = 2 0 ' PLANNED DEVELOPMENT PERMIT CAMBRIA HOTEL & SUITES BY CHOICE HOTELS 101 East Katella Avenue, Anaheim, CA, 92802 A P P L I C A N T H O T E L G R O U P AWBREY COOK ROGERS MCGILL ARCHITECTS P R O J E C T C O N S U L T A N T 1 M a c A r t h u r P l a c e , S u i t e 3 0 0 S a n t a A n a , C A 9 2 7 0 7 P h : ( 7 1 4 ) 5 4 6 - 5 6 0 0 F x : ( 7 1 4 ) 5 4 6 - 5 6 6 0 A C R M P R O J E C T N O . 1 6 - 3 3 0 2 I S S U E D F O R : D A T E : J U L Y 2 6 , 2 0 1 6 D E V E L O P M E N T A P P L I C A T I O N A G E N T O C T . 0 3 , 2 0 1 6 D E V E L O P M E N T A P P . R E - S U B M I T T A L S H E E T S H E E T N O . N O V . 0 7 , 2 0 1 6 D E V E L O P M E N T A P P . R E - S U B M I T T A L TreesShrubs, Vines & Groundcovers LOPHOSTEMON CONFERTUS /BRISBANE BOX PODOCARPUS GRACILIOR /FERN PINE L A G E R S T R O E M I A I . ' M U S K O G E E ' / M U S K O G E E C R A P E M Y R T L E W A S H I N G T O N I A H Y B R I D / H Y B R I D M E X I C A N F A N P A L M P H O E N I X D A C T Y L I F E R A ' M E D J O O L ' / M E D J O O L D A T E P A L M CALLISTEMON 'LITTLE JOHN' /DWARF BOTTLE BRUSH CARISSA M. 'GREEN CARPET' /DWARF NATAL PLUM H E M E R O C A L L I S H Y B R I D / D A Y L I L Y L A N T A N A ' N E W G O L D ' / N E W G O L D L A N T A N A L I G U S T R U M J . ' T E X A N U M ' / T E X A S P R I V E T PHILODENDRON 'XANADU' /XANADU PHILODENDRON PHORMIUM T. 'DAZZLER' /DAZZLER NEW ZEALAND FLAX R O S M A R I N U S O . ' P R O S T R A T U S ' / P R O S T R A T E R O S E M A R Y S T R E L I T Z I A N I C O L A I / G I A N T B I R D O F P A R A D I S E S T R E L I T Z I A R E G I N A E / B I R D O F P A R A D I S E PHORMIUM T. 'JAC K S P R A T T ' / DWARF NEW ZEAL A N D F L A X CASSIA LEPTOPHYL L A / GOLD MEDALLION T R E E PLANNED DEVELOPMENT PERMIT CAMBRIA HOTEL & SUITES BY CHOICE HOTELS 101 East Katella Avenue, Anaheim, CA, 92802 A P P L I C A N T H O T E L G R O U P AWBREY COOK ROGERS MCGILL ARCHITECTS P R O J E C T C O N S U L T A N T 1 M a c A r t h u r P l a c e , S u i t e 3 0 0 S a n t a A n a , C A 9 2 7 0 7 P h : ( 7 1 4 ) 5 4 6 - 5 6 0 0 F x : ( 7 1 4 ) 5 4 6 - 5 6 6 0 A C R M P R O J E C T N O . 1 6 - 3 3 0 2 I S S U E D F O R : D A T E : J U L Y 2 6 , 2 0 1 6 D E V E L O P M E N T A P P L I C A T I O N A G E N T O C T . 0 3 , 2 0 1 6 D E V E L O P M E N T A P P . R E - S U B M I T T A L S H E E T S H E E T N O . N O V . 0 7 , 2 0 1 6 D E V E L O P M E N T A P P . R E - S U B M I T T A L SECTION A: KATELLA AVE S E C T I O N B : A N A H E I M B O U L E V A R D SECTION C: MANCHESTER AVENUE SCALE: 3/16" = 1'-0" S C A L E : 3 / 1 6 " = 1 ' - 0 " SCALE: 3/16" = 1'-0" PLANNED DEVELOPMENT PERMIT CAMBRIA HOTEL & SUITES BY CHOICE HOTELS 101 East Katella Avenue, Anaheim, CA, 92802 A P P L I C A N T H O T E L G R O U P AWBREY COOK ROGERS MCGILL ARCHITECTS P R O J E C T C O N S U L T A N T 1 M a c A r t h u r P l a c e , S u i t e 3 0 0 S a n t a A n a , C A 9 2 7 0 7 P h : ( 7 1 4 ) 5 4 6 - 5 6 0 0 F x : ( 7 1 4 ) 5 4 6 - 5 6 6 0 A C R M P R O J E C T N O . 1 6 - 3 3 0 2 I S S U E D F O R : D A T E : J U L Y 2 6 , 2 0 1 6 D E V E L O P M E N T A P P L I C A T I O N A G E N T O C T . 0 3 , 2 0 1 6 D E V E L O P M E N T A P P . R E - S U B M I T T A L S H E E T S H E E T N O . N O V . 0 7 , 2 0 1 6 D E V E L O P M E N T A P P . R E - S U B M I T T A L TUBULAR STEEL FENCE 7 6 5SECTION - ELEVATION 2131LEGEND:1.2" SQ. TUBULAR STEEL TOP, BOTTOM ANDFRAME RAIL2.2" SQ. TUBULAR STEEL POST3.5/8" SQ. STEEL PICKETS @ 3-3/4" CLR.4.ADJACENT PAVING5.FINISH GRADE6.CONCRETE POST FOOTING7.90% COMPACTED SUBGRADE OR PER SOILREPORTNOTES:A.PROVIDE LANDSCAPE ARCHITECT W/ (2) SETSOF SHOP DRAWINGS FOR REVIEW ANDAPPROVAL PRIOR TO FABRICATION.B.ALL WELDS TO BE CONTINUOUS, GROUNDSMOOTH.C.PAINT ALL STEEL SURFACES WITH (1) COATSHOP- APPLIED RUST-PROOF GRAY PRIMER, (1)COAT FIELD-APPLIED RED PRIMER AND (2)COATS EXTERIOR ENAMEL PAINT, COLOR TOMATCH SLIDING GATE BY ARCHITECT FINALCOLOR TO BE APPROVED BY OWNER'SREPRESENTATIVE 8 X 8 X 1 6 C O N C R E T E B L O C K , G R O U T F I L L A L L C E L L S W I T H S T E E L C O N C R E T E F O O T I N G , D I M E N S I O N S A N D R E I N F O R C E M E N T S P E R S T R U C T U R A L P L A S T E R F I N I S H P E R C O L O R A N D F I N I S H S C H E D U L E 2 : 1 S L O P E A N D V - D I T C H P E R C I V I L E N G I N E E R ' S D R A W I N G S R E T A I N I N G W A L L A N D F O O T I N G P E R C I V I L E N G I N E E R ' S D R A W I N G S R E I N F O R C E M E N T P E R S T R U C T U R A L E N G I N E E R ' S S P E C I F I C A T I O N S F I N I S H G R A D E E N G I N E E R ' S S P E C I F I C A T I O N S S C R E E D L I N E 1 0 . 9 . 8 . 7 . 5 . 4 . 3 . 6 . 4 9 0 % C O M P A C T E D S U B G R A D E - V E R I F Y W / S O I L E N G I N E E R ' S R E P O R T P R E C A S T C O N C R E T E C A P L E G E N D : 1 . 2 . 4 4 1 0 9 7 2 6 3 1 TW PER PLAN F R E E S T A N D I N G P L A S T E R W A L L W I T H C O N C R E T E C A P 2 82'-3" - 1- CITY OF ANAHEIM ENVIRONMENTAL CHECKLIST FORM CASE NOS.: Final Site Plan No. 2016-00004, Development Project No. 2016-00038 SITE ADDRESS: 101 East Katella Avenue, Anaheim, CA 92802 APNs: 082-23-077, 082-23-073, and 082-23-072 LOCATION: North of Katella Avenue between I-5 and Manchester Avenue to the East and S Anaheim Boulevard to the West ENVIRONMENTAL FACTORS POTENTIALLY AFFECTED: The environmental factors checked below would be potentially affected by this Project, involving at least one impact that is a "Potentially Significant Impact" as indicated by the checklist on the following pages.  Aesthetic / Visual  Agricultural & Forestry  Air Quality  Biological Resources  Cultural Resources  Geology / Soils  Greenhouse Gas Emissions  Hazards & Hazardous Materials  Hydrology / Water Quality  Land Use / Planning  Mineral Resources  Noise  Population / Housing  Public Services  Recreation  Transportation / Traffic  Utilities / Service Systems  Mandatory Findings of Significance DETERMINATION: (To be completed by the City) On the basis of this initial evaluation:  I find that the proposed Project COULD NOT have a significant effect on the environment, and a NEGATIVE DECLARATION will be prepared.  I find that although the proposed Project could have a significant effect on the environment, there will not be a significant effect in this case because revisions in the Project have been made by or agreed to by the Project proponent. A MITIGATED NEGATIVE DECLARATION will be prepared.  I find that the proposed Project MAY have a significant effect on the environment, and an ENVIRONMENTAL IMPACT REPORT is required.  I find that the proposed Project MAY have a “potentially significant impact” or “potentially significant unless mitigated” impact on the environment, but at least one effect 1) has been adequately analyzed in an earlier document pursuant to applicable legal standards, and 2) has been addressed by mitigation measures based on the earlier analysis as described on attached sheets. An ENVIRONMENTAL IMPACT REPORT is required, but it must analyze only the effects that remain to be addressed.  I find that although the proposed Project could have a significant effect on the environment, because all potentially significant effects 1) have been analyzed adequately in an earlier EIR or NEGATIVE DECLARATION pursuant to applicable standards, and 2) have been avoided or mitigated pursuant to that earlier EIR or NEGATIVE DECLARATION, including revisions or mitigation measures that are imposed upon the proposed Project, nothing further is required. 11/17/16 Signature of City of Anaheim Representative Date Elaine Thienprasiddhi, Senior Planner (714) 765-4568 Printed Name, Title Phone Number ATTACHMENT NO. 5 - 2- EVALUATION OF ENVIRONMENTAL IMPACTS: 1) All answers must take account of the whole action involved, including offsite as well as onsite, cumulative as well as project-level, indirect as well as direct, and construction as well as operational impacts. 2) A list of “Supporting Information Sources” must be attached and other sources used or individuals contacted should be cited in the Narrative Summary for each section. 3) Response column heading definitions: a) Potentially Significant Impact is appropriate if there is substantial evidence that an effect may be significant. If there are one or more “Potentially Significant Impact” entries when the determination is made, an Environmental Impact Report (EIR) is required. b) Potentially Significant Unless Mitigation Incorporated applies where the incorporation of mitigation measures has reduced an effect from “Potentially Significant Impact” to a “Less Than Significant Impact”. The mitigation measures must be described, along with a brief explanation of how they reduce the effect to a less than significant level. c) Less Than Significant Impact applies where the Project creates no significant impacts, only “Less Than Significant impacts”. d) No Impact applies where a Project does not create an impact in that category. A “No Impact” answer is adequately supported if the referenced information sources show that the impact simply does not apply to projects like the one proposed (e.g., the project falls outside of a fault rupture zone). A “No Impact” answer should be explained where it is based on project-specific factors as well as general standards (e.g., the project will not expose sensitive receptors to pollutants, based on a project-specific screening analysis). 4) Earlier analyses may be used where, pursuant to a tiering, program EIR, Master EIR, or other California Environmental Quality Act (CEQA) process, an effect has been adequately analyzed in an earlier EIR or negative declaration (§ 15062(c)(3)(D)). In this case, a brief discussion should identify the following: a) Earlier Analysis Used. Identify and state where they are available for review. b) Impacts Adequately Addressed. Identify which effects from the checklist were within the scope of and adequately analyzed in an earlier document pursuant to applicable legal standards, and state whether such effects were addressed by mitigation measures based on the earlier analysis. c) Mitigation Measures. For effects that are “Less than Significant with Mitigation Measures Incorporated”, describe the mitigation measures which were incorporated or refined from the earlier document and the extent to which they address site-specific conditions for the Project. 5) Incorporate into the checklist any references to information sources for potential impacts (e.g., the General Plan, zoning ordinance). Reference to a previously prepared or outside document should, where appropriate, include a reference to the page or pages where the statement is substantiated. 6) The explanation of each issue should identify: a) The significance criteria or threshold, if any, used to evaluate each question; and b) The mitigation measure identified, if any, to reduce the impact to less than significant. - 3- Project Setting The project site is located at 101 East Katella Avenue in the City of Anaheim. The 5.89-acre project site is comprised of three parcels (APNs 082-230-72/0.4 acres, 082-230-73/1.43 acres, and 082-230-77/4.06 acres), which are currently developed with a Del Taco drive-through restaurant, surface parking lot, and two concrete pads where former buildings have been demolished, respectively. The three parcels are located within the General Plan designation for Commercial Recreation (C-R) land use, and the Medium Density Commercial Recreation (CR) District of the Anaheim Resort Specific Plan (ARSP) No. 92-2 (SP 92-2) Zone. Anaheim Municipal Code Chapter 18.116.060 allows up to 100 rooms per gross acre or 75 rooms per lot or parcel existing on the date of adoption of the ARSP, whichever is greater. Since the adoption of the ARSP, these parcels were altered to allow for the widening and realignment of Katella Avenue, resulting in a net acreage loss from 7.0 acres to the current approximately 5.89 acres. However, the density for these parcels is analyzed at the time the ARSP was adopted, as shown in Table 1 below. Table 1 Project Site Acreage at Time of Adoption of ARSP APN Max Rooms/Acre Analysis Acres Buildout Max # Rooms 082-230-72 100 1.3 130 082-230-73 100 .5 75 082-230-77 100 5.2 520 7.0 725 The site is surrounded by: Interstate 5 (I-5) Freeway and southbound off-ramp to Katella Avenue to the north/northeast; Motel 6, Candlewood Suites Anaheim Resort, Peacock Suites Resort Hotel, a commercial laundry, and 7-11 to the west across S Anaheim Blvd; and a strip retail center and Comfort Inn & Suites to the south across E Katella Avenue. Surrounding properties to the west and south are also designated for Commercial Recreation land use by the Anaheim General Plan. The subject property, in its existing condition, is shown in Figure 1- Existing Conditions on Page 5. - 4- Figure 1 – Existing Conditions - 5- Project Description The applicant proposes to demolish the existing Del Taco drive-through restaurant and construct a new Cambria Suites hotel with 352-rooms, various guest amenities, including a breakfast room, meeting room, bar and lounge, fitness room, game room, and outdoor recreation area. The recreation area would include water slides, two pools, spa, splash pad, movie screen, putting green, and sport court. The development would also include three freestanding quick-service restaurants along Katella Avenue, with a total area of 15,641 square feet. The three restaurant pads would anchor the southwest corner of the property at Katella Avenue and Anaheim Boulevard; the hotel would be situated to the north along Anaheim Boulevard; the outdoor recreation area would be at the north end of the property; and the remainder of the site would be improved with surface parking, vehicular circulation and landscaping with one level of subterranean parking located in the center of the site. Vehicle access to the site would be provided by driveways from each of the abutting streets. The hotel drop off area includes a circular porte cochere and parking for hotel guests would include gate controlled access to the underground parking level. The restaurants would have ample surface parking immediately in front of the restaurants and at the southeast corner of the property. Proposed landscaping includes several shade, flowering and vertical tree species, as well as a variety of shrubs and groundcovers. Landscaping within the public parkway would match the existing landscape design along Katella Avenue and include Date Palms and Giant Agapanthus. Layered landscaping is proposed in all street setbacks, along with a variety of trees to break up the massing of the buildings. The subject property was reclassified to the CR District of the SP 92-2 Zone in September 1994, concurrent with the adoption of the Anaheim Resort Specific Plan (ARSP) and the certification of Master Environmental Impact Report No. 313 (MEIR No. 313). This master environmental impact report has served as the environmental documentation for projects that are implemented in accordance with the ARSP. The analysis in MEIR No. 313 was supplemented by the certification of Supplemental Environmental Impact Report No. 340 (SEIR No. 340), adopted in December, 2012. Any impacts are addressed by mitigation measures set forth in Mitigation Monitoring Plan No. 337, created for this project from Updated and Modified Mitigation Monitoring Program No. 85C (adopted in conjunction with the certification of SEIR No. 340). Applicable mitigation measures will be applied to this project and impacts would be less than significant. Entitlements for this project include Final Site Plan No. 2016-00004 to determine compliance with the Anaheim Resort Specific Plan. - 6- I. AESTHETICS -- Would the Project: Potentially Significant Impact Less Than Significant with Mitigation Less Than Significant Impact Impacts analyzed in SEIR No. 340 No New Impact No Impact a) Have a substantial adverse effect on a scenic vista?      b) Substantially damage scenic resources, including, but not limited to, trees, rock outcroppings, and historic buildings within a State scenic highway or local scenic expressway, scenic highway, or eligible scenic highway?      c) Substantially degrade the existing visual character or quality of the site and its surroundings?      d) Create a new source of substantial light or glare which would adversely affect day or nighttime views in the area?      Narrative Summary: Impacts analyzed in SEIR No. 340/No new impacts. SEIR No. 340 analyzed the aesthetic impacts related to the implementation of the Anaheim Resort Specific Plan No. 92-2. Refer to SEIR No. 340, Section 4.3.1. According to SEIR No. 340, the ARSP area does not contain any scenic resources, nor are any scenic vistas visible from the ARSP area; therefore, no impact would occur. Future development and redevelopment associated with buildout of the ARSP area would change the existing visual character of individual areas; however, buildout of the ARSP area would create a more visually cohesive and appealing environment and impacts would be less than significant with implementation of the recommended mitigation program. The proposed project would not impact any scenic vistas or degrade the existing visual character of the surrounding area. The architecture would blend in with the existing adjacent buildings and enhance The Anaheim Resort with an aesthetically pleasing structure. The new structure would be taller than the existing structure, but would be in compliance with the height limitations and structural setbacks required by the ARSP. A shade/shadow analysis was prepared to evaluate any potential impacts that the taller hotel structure may have on neighboring properties. The project would not negatively affect the shade/shadows on the adjacent hotel structures or developments in either the summer or winter months. The proposed project would not result in any impacts beyond those identified in the previously certified SEIR No. 340. Any impacts are addressed by mitigation measures set forth in Mitigation Monitoring Plan No. 337, created for this project from Updated and Modified Mitigation Monitoring Program No. 85C (SEIR No. 340 for the Anaheim Resort Specific Plan No. 92-2). Applicable mitigation measures will be applied to this project and impacts would be less than significant. II. AGRICULTURE RESOURCES -- In determining whether Impacts to agricultural resources are significant environmental effects, lead agencies may refer to the California Agricultural Land Evaluation and Site Assessment Model (1997) prepared by the California Department of Conservation (DOC) as an optional model to use in assessing impacts on agriculture and farmland. Would the Project: Environmental Issues Potentially Significant Impact Less Than Significant with Mitigation Less Than Significant Impact Impacts analyzed in SEIR No. 340 No New Impact No Impact - 7- a) Convert Prime Farmland, Unique Farmland, or Farmland of Statewide Importance (Farmland), as shown on the maps prepared pursuant to the Farmland Mapping and Monitoring Program of the California Resources Agency, to non-agricultural use?      b) Conflict with existing zoning for agricultural use, or a Williamson Act contract?      c) Conflict with existing zoning for, or cause rezoning of, forest land (as defined in Public Resources Code § 12220(g)), timberland (as defined by Public Resources Code § 4526), or timberland zoned Timberland Production (as defined by Government Code § 51104(g))?      d) Result in the loss of forest land or conversion of forest land to non-forest use?      e) Involve other changes in the existing environment which, due to their location or nature, could result in conversion of Farmland, to non-agricultural use or conversion of forest land to non-forest use?      Narrative Summary: No Impact (a – e). The project area is not located in an area with agricultural or forest uses. There is no unique, prime or farmland of statewide importance located within the project area. There are no Williamson Act contracts within the project area. No impacts would occur. III. AIR QUALITY -- Where available, the significance criteria established by the applicable air quality management or air pollution control district may be relied upon to make the following determinations. Would the Project: Environmental Issues Potentially Significant Impact Less Than Significant with Mitigation Less Than Significant Impact Impacts analyzed in SEIR No. 340 No New Impact No Impact a) Conflict with or obstruct implementation of the applicable air quality plan?      b) Violate any air quality standard or contribute substantially to an existing or projected air quality violation?      c) Result in a cumulatively considerable net increase of any criteria pollutant for which the project region is non- attainment under an applicable Federal or State ambient air quality standard (including releasing emissions which exceed quantitative thresholds for ozone precursors)?      d) Expose sensitive receptors to substantial pollutant concentrations?      e) Create objectionable odors affecting a substantial number of people?      - 8- Narrative Summary: Impacts analyzed in SEIR No. 340/No new impacts. SEIR No. 340 addressed the air quality impacts associated with implementation of the Anaheim Resort Specific Plan No. 92-2. Refer to SEIR No. 340, Section 4.3.2. SEIR No. 340 concluded that, with implementation of all identified mitigation measures, mass emissions resulting from construction-related activities would be less than significant. However, because of uncertainties in the timing and magnitude of emissions for possible projects, it was concluded that cumulative emissions from construction would be significant and unavoidable. It was also concluded that local concentrations of particulate matter with a diameter of 10 microns or less (PM10) and fine particulate matter with a diameter of 2.5 microns or less (PM2.5) would exceed the South Coast Air Quality Management District’s (SCAQMD’s) CEQA significance thresholds for short-term periods when excavation would occur near sensitive receptors; the impact would be significant and unavoidable. The Anaheim City Council adopted a Statement of Overriding Considerations with regard to this potential impact. Emissions of criteria pollutants resulting from operation of the full buildout of the ARSP would exceed the SCAQMD applicable thresholds for volatile organic compounds (VOC), nitrogen oxides (NOx), carbon monoxide (CO), PM10, and PM2.5. Operation would result in direct and cumulative significant and unavoidable impacts. The Anaheim City Council adopted a Statement of Overriding Considerations with regard to these potential impacts. Because implementation of the ARSP could result in an increase in the frequency or severity of existing air quality violations, SEIR No. 340 concluded that the ARSP could conflict with or obstruct implementation of the 2007 AQMP, thereby resulting in a significant and unavoidable impact. The Anaheim City Council adopted a Statement of Overriding Considerations with regard to this potential impact. Construction and operation of the ARSP would not expose sensitive receptors to substantial pollutant toxic air contaminants (TACs); would not expose sensitive receptors to substantial CO local concentrations; and would not create objectionable odors. These impacts would be less than significant. The ARSP allows for up to 100 rooms per gross acre or 75 rooms per lot or parcel existing on the date of adoption of the ARSP, whichever is greater, or the equivalent of 600 square feet of visitor serving uses per hotel room. Therefore, the air quality analysis in SEIR No. 340 analyzed the operational impacts of the development of up to approximately 725 hotel rooms on the 7.0 acre property, which was subsequently reduced to 5.89 acres with the widening and realignment of Katella Avenue. The applicant proposes to demolish the existing Del Taco drive –through and surface parking lot and construct a 352-room, 12-story hotel and three restaurant pads totaling 15,641 square feet (equivalent to 27 rooms). As a result, the proposed project is equivalent to 379 rooms and falls under the maximum amount of development analyzed in SEIR No. 340. The proposed project would not result in any construction or operational impacts beyond those identified in the previously certified SEIR No. 340. Any impacts are addressed by mitigation measures set forth in Mitigation Monitoring Plan No. 337, created for this project from Updated and Modified Mitigation Monitoring Program No. 85C (SEIR No. 340 for the Anaheim Resort Specific Plan No. 92-2). Applicable mitigation measures will be applied to this project and impacts would be less than significant. IV. BIOLOGICAL RESOURCES -- Would the Project: Environmental Issues Potentially Significant Impact Less Than Significant with Mitigation Less Than Significant Impact Impacts analyzed in SEIR No. 340 No New Impact No Impact a) Have a substantial adverse effect, either directly or through habitat modifications, on any species identified as a candidate, sensitive, or special status species in local or regional plans, policies, or regulations, or by the California Department of Fish and Wildlife or United States Fish and Wildlife Service?      - 9- b) Have a substantial adverse effect on any riparian habitat or other sensitive natural community identified in local or regional plans, policies, and regulations or by the California Department of Fish and Game or US Fish and Wildlife Service?      c) Have a substantial adverse effect on federally protected wetlands as defined by § 404 of the Clean Water Act (including, but not limited to, marsh, vernal pool, coastal, etc.) through direct removal, filling, hydrological interruption, or other means?      d) Interfere substantially with the movement of any native resident or migratory fish or wildlife species or with established native resident or migratory wildlife corridors, or impede the use of native wildlife nursery sites?      e) Conflict with any local policies or ordinances protecting biological resources, such as a tree preservation policy or ordinance?      f) Conflict with the provisions of an adopted Habitat Conservation Plan, Natural Community Conservation Plan, or other approved local, regional, or State habitat conservation plan?      Narrative Summary: Impacts analyzed in SEIR No. 340/No new impacts. SEIR No. 340 addressed the potential impacts to biological resources associated with implementation of the Anaheim Resort Specific Plan No. 92-2. Refer to SEIR No. 340, Section 4.3.3. SEIR No. 340 identified that the ARSP area is located within an urbanized area of the City with no Candidate, Sensitive, or Special Status Species as listed in local regional plans, policies, or regulations, or as designated by the California Department of Fish and Wildlife1 (CDFW) or the U.S. Fish and Wildlife Service (USFWS). Further, SEIR No. 340 concluded that the ARSP area does not function as a migratory corridor or a native wildlife nursery site and no impact would occur. The proposed project site and surrounding areas are urbanized and no significant plant or animal resources are located on or within the immediate vicinity. There are no wetlands or wildlife corridors or nurseries on or in the vicinity of the site. In addition, the site is not located within a designated HCP or NCCP area. The proposed project would not result in any impacts beyond those identified in the previously certified SEIR No. 340. Any impacts are addressed by mitigation measures set forth in Mitigation Monitoring Plan No. 337, created for this project from Updated and Modified Mitigation Monitoring Program No. 85C (SEIR No. 340 for the Anaheim Resort Specific Plan No. 92-2). Applicable mitigation measures will be applied to this project and impacts would be less than significant. V. CULTURAL RESOURCES -- Would the Project: Environmental Issues Potentially Significant Impact Less Than Significant with Mitigation Less Than Significant Impact Impacts analyzed in SEIR No. 340 No New Impact No Impact 1 California Department of Fish and Wildlife is previously known, and referred to in SEIR No. 340, as the California Department of Fish and Game. - 10- a) Cause a substantial adverse change in the significance of a historical resource as defined in CEQA Guidelines §15064.5 and/or identified on the Anaheim Citywide Historic Preservation Plan.      b) Cause a substantial adverse change in the significance of an archaeological resource pursuant to CEQA Guidelines § 15064.5?      c) Directly or indirectly destroy a unique paleontological resource or site or unique geologic feature?      d) Disturb any human remains, including those interred outside of formal cemeteries?      Narrative Summary: Impacts analyzed in SEIR No. 340/No new impacts. SEIR No. 340 addressed the potential impacts to cultural resources associated with implementation of the Anaheim Resort Specific Plan No. 92-2. Refer to SEIR No. 340, Section 4.3.4. According to SEIR No. 340, no designated historical resources exist within the ARSP area. Further, no resources are anticipated to be discovered in the ARSP area. SEIR No. 340 concluded that there is no evidence of human remains in the ARSP area and that adherence to Section 5097.98 of the California Public Resources Code and California Health and Section 7050.5 of the California Health and Safety Code would ensure that a significant impact would not occur. The proposed project site is urbanized and no known cultural resources are located on or in the vicinity of the site. There are no historic structures on the site. In addition, there are no known archaeological or paleontological resources. And there are no known burial sites on the proposed project site. The proposed project would not result in any impacts beyond those identified in the previously certified SEIR No. 340. Any impacts are addressed by mitigation measures set forth in Mitigation Monitoring Plan No. 337, created for this project from Updated and Modified Mitigation Monitoring Program No. 85C (SEIR No. 340 for the Anaheim Resort Specific Plan No. 92-2). Applicable mitigation measures will be applied to this project and impacts would be less than significant. VI. GEOLOGY AND SOILS -- Would the Project: Environmental Issues Potentially Significant Impact Less Than Significant with Mitigation Less Than Significant Impact Impacts analyzed in SEIR No. 340 No New Impact No Impact a) Expose people or structures to potential substantial adverse effects, including the risk of loss, injury, or death involving: i) Rupture of a known earthquake fault, as delineated on the most recent Alquist-Priolo Earthquake Fault Zoning Map issued by the State Geologist for the area or based on other substantial evidence of a known fault?      ii) Strong seismic ground shaking?      iii) Seismic-related ground failure, including liquefaction?      iv) Landslides?      - 11- b) Result in substantial soil erosion or the loss of topsoil?      c) Be located on a geologic unit or soil that is unstable, or that would become unstable as a result of the project, and potentially result in on- or off-site landslide, lateral spreading, subsidence, liquefaction or collapse?      d) Be located on expansive soil, as defined in Table 18-1- B of the Uniform Building Code (1994), creating substantial risks to life or property?      e) Have soils incapable of adequately supporting the use of septic tanks or alternative wastewater disposal systems where sewers are not available for the disposal of wastewater?      Narrative Summary: Impacts analyzed in SEIR No. 340/No new impacts. SEIR No. 340 analyzed the geotechnical and soils impacts related to the implementation of the Anaheim Resort Specific Plan No. 92-2. Refer to SEIR No. 340, Section 4.3.5. SEIR No. 340 identified active and potentially active faults in the region that could result in seismic-related impacts to future development projects associated with the buildout of the ARSP. Seismic events along these faults have the potential to result in strong ground motion. SEIR No. 340 concluded that potential impacts related to seismic ground shaking would be reduced to less than significant levels with implementation of project specific mitigation measures (if required); conformance with the applicable requirements listed in the Anaheim Municipal Code; and with conformance to the California Building Code. As noted in SEIR No. 340, the ARSP area is located in a relatively flat area with minimal potential for erosion impacts due to the high amount of urban development and low amount of bare ground. However, during demolition and construction activities when areas are exposed to erosion and loss of topsoil, adherence to the following would ensure that impacts would be less than significant: local and State codes and requirements for erosion control and grading; compliance with the National Pollutant Discharge Elimination System (NPDES) permit and the subsequent development of a Storm Water Pollution Prevention Plan (SWPPP). The proposed project would not result in any impacts beyond those identified in the previously certified SEIR No. 340. Any impacts are addressed by mitigation measures set forth in Mitigation Monitoring Plan No. 337, created for this project from Updated and Modified Mitigation Monitoring Program No. 85C (SEIR No. 340 for the Anaheim Resort Specific Plan No. 92-2). Project impacts would be less than significant. VII. GREENHOUSE GAS EMISSIONS -- Would the Project: Environmental Issues Potentially Significant Impact Less Than Significant with Mitigation Less Than Significant Impact Impacts analyzed in SEIR No. 340 No New Impact No Impact a) Generate greenhouse gas emissions, either directly or indirectly, that may have a significant impact on the environment?      b) Conflict with an applicable plan, policy or regulation adopted for the purpose of reducing the emissions of greenhouse gases?      - 12- Narrative Summary: Less Than Significant Impact. Impacts analyzed in SEIR No. 340/No new impacts. SEIR No. 340 analyzed the potential impacts from greenhouse gas emissions related to the implementation of the Anaheim Resort Specific Plan No. 92-2. Refer to SEIR No. 340, Section 4.3.6. SEIR No. 340 concluded that although the proposed project would not conflict with applicable regulations and policies adopted for the purpose of reducing greenhouse gas (GHG) emissions and although feasible mitigation measures would be incorporated into the proposed project, the magnitude of the increase in GHG emissions would remain cumulatively considerable and the impact to GHG emissions would be significant and unavoidable. The Anaheim City Council adopted a Statement of Overriding Considerations with regard to these potential impacts. The ARSP allows for up to 100 rooms per gross acre or 75 rooms per lot or parcel existing on the date of adoption of the ARSP, whichever is greater, or the equivalent of 600 square feet of visitor serving uses per hotel room. Therefore, the air quality analysis in SEIR No. 340 analyzed the operational impacts of the development of up to approximately 725 hotel rooms on the 7.0 acre property, which was subsequently reduced to 5.89 acres with the widening and realignment of Katella Avenue. The applicant proposes to demolish the existing Del Taco drive –through and surface parking lot and construct a 352-room, 12-story hotel and three restaurant pads totaling 15,641 square feet (equivalent to 27 rooms). As a result, the proposed project is equivalent to 379 rooms and falls under the maximum amount of development analyzed in SEIR No. 340. The proposed project would not result in any impacts beyond those identified in the previously certified SEIR No. 340. Any impacts are addressed by mitigation measures set forth in Mitigation Monitoring Plan No. 337, created for this project from Updated and Modified Mitigation Monitoring Program No. 85C (SEIR No. 340 for the Anaheim Resort Specific Plan No. 92-2). Project impacts would be less than significant. VIII. HAZARDS AND HAZARDOUS MATERIALS -- Would the Project: Environmental Issues Potentially Significant Impact Less Than Significant with Mitigation Less Than Significant Impact Impacts analyzed in SEIR No. 340 No New Impact No Impact a) Create a significant hazard to the public or the environment through the routine transport, use, or disposal of hazardous materials?      b) Create a significant hazard to the public or the environment through reasonably foreseeable upset and accident conditions involving the release of hazardous materials into the environment?      c) Emit hazardous emissions or handle hazardous or acutely hazardous materials, substances, or waste within one-quarter mile of an existing or proposed school?      d) Be located on a site which is included on a list of hazardous materials sites compiled pursuant to Government Code § 65962.5 and, as a result, would it create a significant hazard to the public or the environment?      e) For a project located within an airport land use plan (Los Alamitos Armed Forces Reserve Center or Fullerton Municipal Airport), would the project result in a safety hazard for people residing or working in the project area?      - 13- f) For a project within the vicinity of a private airstrip, heliport or helistop, would the project result in a safety hazard for people residing or working in the project area?      g) Impair implementation of, or physically interfere with, an adopted emergency response plan or emergency evacuation plan?      h) Expose people or structures to a significant risk of loss, injury or death involving wildland fires, including where wildlands are adjacent to urbanized areas or where residences are intermixed with wildlands?      Narrative Summary: Impacts analyzed in SEIR No. 340/No new impacts. SEIR No. 340 analyzed the hazards and hazardous materials impacts related to the implementation of the Anaheim Resort Specific Plan No. 92-2. Refer to SEIR No. 340, Section 4.3.7. According to SEIR No. 340, buildout of the ARSP would have the potential to disturb lead-based paints (LBP) and asbestos- containing materials (ACM) depending on the age of existing structures in the ARSP area. The existing building on the site that is to be demolished was constructed in 1961. With implementation of mitigation, including compliance with the State of California Hazardous Substances Control Law, potential impacts related to hazardous material on or near the ARSP area would be reduced to less than significant levels. The proposed project would not result in any impacts beyond those identified in the previously certified SEIR No. 340. Any impacts are addressed by mitigation measures set forth in Mitigation Monitoring Plan No. 337, created for this project from Updated and Modified Mitigation Monitoring Program No. 85C (SEIR No. 340 for the Anaheim Resort Specific Plan No. 92-2). Project impacts would be less than significant. IX. HYDROLOGY AND WATER QUALITY -- Would the Project: Environmental Issues Potentially Significant Impact Less Than Significant with Mitigation Less Than Significant Impact Impacts analyzed in SEIR No. 340 No New Impact No Impact a) Violate any water quality standards or waste discharge requirements?      b) Substantially deplete groundwater supplies or interfere substantially with groundwater recharge such that there would be a net deficit in aquifer volume or a lowering of the local groundwater table level (e.g., the production rate of pre-existing nearby wells would drop to a level which would not support existing land uses or planned uses for which permits have been granted)?      c) Substantially alter the existing drainage pattern of the site or area, including through the alteration of the course of a stream or river, in a manner which would result in substantial erosion or siltation on- or off-site?      d) Substantially alter the existing drainage pattern of the site or area, including through the alteration of the course of a stream or river, or substantially increase the rate or amount of surface runoff in a manner which would result in flooding on- or off-site?      - 14- e) Create or contribute runoff water which would exceed the capacity of existing or planned stormwater drainage systems or provide substantial additional sources of polluted runoff?      f) Otherwise substantially degrade water quality?      g) Place housing within a 100-year flood hazard area as mapped on a federal Flood Hazard Boundary or Flood Insurance Rate Map or other flood hazard delineation map?      h) Place within a 100-year flood hazard area structures which would impede or redirect flood flows?      i) Expose people or structures to a significant risk of loss, injury or death involving flooding, including flooding as a result of the failure of a levee or dam?      j) Expose persons or structures to risk of inundation by seiche or mudflow?      k) Substantially degrade water quality by contributing pollutants from areas of material storage, vehicle or equipment fueling, vehicle or equipment maintenance (including washing), waste handling, hazardous materials handling, or storage, delivery areas, loading docks or other outdoor work areas?      l) Substantially degrade water quality by discharge which affects the beneficial uses (i.e., swimming, fishing, etc.) of the receiving or downstream waters?      Narrative Summary: Impacts analyzed in SEIR No. 340/No new impacts. SEIR No. 340 analyzed the hydrology and water quality impacts related to the implementation of the Anaheim Resort Specific Plan No. 92-2. Refer to SEIR No. 340, Section 4.3.8. According to SEIR No. 340, implementation of the ARSP project would result in short-term construction-related and long- term operational water quality impacts. However, implementation of mitigation measures and compliance with the standard requirements reduces these impacts. Although direct impacts to the underlying groundwater resources would not occur, indirect impacts associated with the anticipated increase in long-term demand for domestic water, landscape irrigation, and maintenance activities would be significant. Implementation of the proposed mitigation would reduce demand for groundwater resources. As identified in SEIR No. 340, implementation of the ARSP project would result in site-specific changes to drainage patterns on development sites, but would not adversely impact regional hydrology or drainage flows in the surrounding area. It was found that potential increases in impervious surfaces could increase runoff rates and volumes, while reducing potential for soil erosion. Additionally, the ARSP project has the potential to increase runoff volumes and rates to exacerbate existing deficiencies, potentially leading to localized street flooding. Preliminary Water Quality Management Plan (WQMP) Cambria Hotel & Suites by Choice Hotels was prepared for the proposed project. Under post development conditions, the proposed development will convey subareas throughout the site into a proposed private storm drain system, which ultimately connects to the existing public storm drain system within Katella Avenue, and will generally maintain the same drainage pattern as the pre-development condition. At project completion, the rooftops will drain to the building’s storm drain system connecting to the onsite storm drain. Surface drainage will sheet flow to curb and gutter flowing to grated inlets which connect to the onsite storm drain system. The onsite storm drain leaves the site at a location south of the buildings, and will be treated by a sub-surface retention system (StormTech Chamber) prior to joining the public storm drain at Katella Avenue. The storm drain drains to Anaheim Barber - 15- City Channel, located in the Anaheim Bay-Huntington Harbor Watershed. The proposed project would not result in any impacts beyond those identified in the previously certified SEIR No. 340. Any impacts are addressed by mitigation measures set forth in Mitigation Monitoring Plan No. 337, created for this project from Updated and Modified Mitigation Monitoring Program No. 85C (SEIR No. 340 for the Anaheim Resort Specific Plan No. 92-2). Project impacts would be less than significant. X. LAND USE AND PLANNING -- Would the Project: Environmental Issues Potentially Significant Impact Less Than Significant with Mitigation Less Than Significant Impact Impacts analyzed in SEIR No. 340 No New Impact No Impact a) Physically divide an established community?      b) Conflict with any applicable land use plan, policy, or regulation of an agency with jurisdiction over the project (including, but not limited to the general plan, specific plan or zoning ordinance) adopted for the purpose of avoiding or mitigating an environmental effect?      c) Conflict with any applicable habitat conservation plan or natural community conservation plan?      Narrative Summary: Impacts analyzed in SEIR No. 340/No new impacts. SEIR No. 340 analyzed the land use impacts related to the implementation of the Anaheim Resort Specific Plan No. 92-2. Refer to SEIR No. 340, Section 4.3.9. SEIR No. 340 concluded that the build out of ARSP would be consistent with the respective goals and policies of local and regional regulatory and planning documents. Specifically, the ARSP build out was found to be consistent with and supportive of the three key principles set forth in the 2012–2035 Regional Transportation Plan/Sustainable Communities Strategy: mobility, economy, and sustainability. Additionally, SEIR No. 340 provided a consistency analysis with all relevant goals and policies identified in the City of Anaheim General Plan. The proposed project would not result in any impacts beyond those identified in the previously certified SEIR No. 340. No impacts would occur. XI. MINERAL RESOURCES -- Would the Project: Environmental Issues Potentially Significant Impact Less Than Significant with Mitigation Less Than Significant Impact Impacts analyzed in SEIR No. 340 No New Impact No Impact a) Result in the loss of availability of a known mineral resource that would be of value to the region and the residents of the state?      b) Result in the loss of availability of a locally-important mineral resource recovery site delineated on a local general plan, specific plan or other land use plan?      Narrative Summary: No Impact. The project area is not located in an area with active mining operations. According to the California Department of Mines and Geology, there are no mineral resources or mining operations located within the project area. No impacts would occur. - 16- XII. NOISE -- Would the Project result in: Environmental Issues Potentially Significant Impact Less Than Significant with Mitigation Less Than Significant Impact Impacts analyzed in SEIR No. 340 No New Impact No Impact a) Exposure of persons to or generation of noise levels in excess of standards established in the local general plan or noise ordinance, or applicable standards of other agencies?      b) Exposure of persons to or generation of excessive groundborne vibration or groundborne noise levels?      c) A substantial permanent increase in ambient noise levels in the project vicinity above levels existing without the project?      d) A substantial temporary or periodic increase in ambient noise levels in the project vicinity above levels existing without the project?      e) For a project located within an airport land use plan (Los Alamitos Armed Forces Reserve Center or Fullerton Municipal Airport), would the project expose people residing or working in the project area to excessive noise levels?      f) For a project within the vicinity of a private airstrip, heliport or helistop, would the project expose people residing or working in the project area to excessive noise levels?      Narrative Summary: Impacts analyzed in SEIR No. 340/No new impacts. SEIR No. 340 analyzed the noise impacts related to the implementation of the Anaheim Resort Specific Plan No. 92-2. Refer to SEIR No. 340, Section 4.3.10. SEIR No. 340 determined that construction activities associated with the ARSP have the potential to significantly impact noise-sensitive receptors. In addition, construction in the ARSP area would have the potential to cause vibration levels that would be noticeable for short periods. Development associated with the ARSP would create long-term land use compatibility issues related to noise and would expose receptors to noise levels in excess of established standards, thereby resulting in potentially significant impacts. However, it was determined that adherence to the standard requirements and implementation of the recommended mitigation measures would reduce long-term, operational impacts. The ARSP allows for up to 100 rooms per gross acre or 75 rooms per lot or parcel existing on the date of adoption of the ARSP, whichever is greater, or the equivalent of 600 square feet of visitor serving uses per hotel room. Therefore, the air quality analysis in SEIR No. 340 analyzed the operational impacts of the development of up to approximately 725 hotel rooms on the 7.0 acre property, which was subsequently reduced to 5.89 acres with the widening and realignment of Katella Avenue. The applicant proposes to demolish the existing Del Taco drive –through and surface parking lot and construct a 352-room, 12-story hotel and three restaurant pads totaling 15,641 square feet (equivalent to 27 rooms). As a result, the proposed project is equivalent to 379 rooms and falls under the maximum amount of development analyzed in SEIR No. 340. The proposed project would not result in any impacts beyond those identified in the previously certified SEIR No. 340. Any impacts are addressed by mitigation measures set forth in Mitigation Monitoring Plan No. 337, created for this project from - 17- Updated and Modified Mitigation Monitoring Program No. 85C (SEIR No. 340 for the Anaheim Resort Specific Plan No. 92-2). Project impacts would be less than significant. XIII. POPULATION AND HOUSING -- Would the Project: Environmental Issues Potentially Significant Impact Less Than Significant with Mitigation Less Than Significant Impact Impacts analyzed in SEIR No. 340 No New Impact No Impact a) Induce substantial population growth in an area, either directly (for example, by proposing new homes and businesses) or indirectly (for example, through extension of roads or other infrastructure)?      b) Displace substantial numbers of existing housing, necessitating the construction of replacement housing elsewhere?      c) Displace substantial numbers of people, necessitating the construction of replacement housing elsewhere?      Narrative Summary: Impacts analyzed in SEIR No. 340/No impact. SEIR No. 340 analyzed the population and housing impacts related to the implementation of the Anaheim Resort Specific Plan No. 92-2. Refer to SEIR No. 340, Section 4.3.11. There is no housing located on the proposed project site. In addition, no housing or people would be displaced due to project construction. The proposed project would not result in any impacts beyond those identified in the previously certified SEIR No. 340. No new impacts would occur. XIV. PUBLIC SERVICES -- Would the Project result in substantial adverse physical Impacts associated with the provision of new or physically altered governmental facilities, the construction of which could cause significant environmental impacts, in order to maintain acceptable service ratios, response times or other performance objectives for any of the public services: Environmental Issues Potentially Significant Impact Less Than Significant with Mitigation Less Than Significant Impact Impacts analyzed in SEIR No. 340 No New Impact No Impact Fire protection?      Police protection?      Schools?      Parks?      Other public facilities?      Narrative Summary: Impacts analyzed in SEIR No. 340/No new impacts. SEIR No. 340 analyzed the impacts on public services related to the implementation of the Anaheim Resort Specific Plan No. 92-2. Refer to SEIR No. 340, Section 4.3.12. SEIR No. 340 determined development of the project area would have a substantial demand for fire and police protection services and would indirectly result in the demand for school services, parks, and libraries. - 18- The ARSP allows for up to 100 rooms per gross acre or 75 rooms per lot or parcel existing on the date of adoption of the ARSP, whichever is greater, or the equivalent of 600 square feet of visitor serving uses per hotel room. Therefore, the air quality analysis in SEIR No. 340 analyzed the operational impacts of the development of up to approximately 725 hotel rooms on the 7.0 acre property, which was subsequently reduced to 5.89 acres with the widening and realignment of Katella Avenue. The applicant proposes to demolish the existing Del Taco drive –through and surface parking lot and construct a 352-room, 12-story hotel and three restaurant pads totaling 15,641 square feet (equivalent to 27 rooms). As a result, the proposed project is equivalent to 379 rooms and falls under the maximum amount of development analyzed in SEIR No. 340, and, thus, would not exceed the maximum amount of public services analyzed. The proposed project would not result in any impacts beyond those identified in the previously certified SEIR No. 340. Any impacts are addressed by mitigation measures set forth in Mitigation Monitoring Plan No. 337, created for this project from Updated and Modified Mitigation Monitoring Program No. 85C (SEIR No. 340 for the Anaheim Resort Specific Plan No. 92-2). Project impacts would be less than significant. XV. RECREATION -- Would the Project: Environmental Issues Potentially Significant Impact Less Than Significant with Mitigation Less Than Significant Impact Impacts analyzed in SEIR No. 340 No New Impact No Impact a) Increase the use of existing neighborhood and regional parks or other recreational facilities such that substantial physical deterioration of the facility would occur or be accelerated?      b) Include recreational facilities or require the construction or expansion of recreational facilities which might have an adverse physical effect on the environment?      Narrative Summary: Impacts analyzed in SEIR No. 340/No new impacts. SEIR No. 340 analyzed the impacts to recreation and recreational facilities related to the implementation of the Anaheim Resort Specific Plan No. 92-2. Refer to SEIR No. 340, Section 4.3.13. No new housing would be constructed that would increase the demand for recreational parks or facilities as a result of the proposed project. Therefore, the proposed project would not result in any impacts beyond those identified in the previously certified SEIR No. 340. No new impacts would occur. XVI. TRANSPORTATION / TRAFFIC -- Would the Project: Environmental Issues Potentially Significant Impact Less Than Significant with Mitigation Less Than Significant Impact Impacts analyzed in SEIR No. 340 No New Impact No Impact a) Conflict with an applicable plan, ordinance or policy establishing measures of effectiveness for the performance of the circulation system, taking into account all modes of transportation including mass transit and non-motorized travel and relevant components of the circulation system, including but not limited to intersections, streets, highways and freeways, pedestrian and bicycle paths, and mass transit?      - 19- b) Conflict with an applicable congestion management program, including, but not limited to level of service standards and travel demand measures, or other standards established by the county congestion management agency for designated roads or highways?      c) Result in a change in air traffic patterns, including either an increase in traffic levels or a change in location those results in substantial safety risks?      d) Substantially increase hazards due to a design feature (e.g., sharp curves or dangerous intersections) or incompatible uses?      e) Result in inadequate emergency access?      f) Conflict with adopted policies, plans, or programs regarding public transit, bicycle, or pedestrian facilities, or otherwise decrease the performance or safety of such facilities?      - 20- Narrative Summary: Impacts analyzed in SEIR No. 340/No new impacts. SEIR No. 340 analyzed the transportation and traffic impacts related to the implementation of the Anaheim Resort Specific Plan No. 92-2. Refer to SEIR No. 340, Section 4.3.14. As evaluated in SEIR No. 340, traffic impacts associated with buildout of the ARSP would result in significant impacts at 21 area intersections, 1 arterial segment, and 3 freeway ramp termini intersections. However, after implementation of the identified mitigation measures, these impacts would be reduced to less than significant levels for all but nine intersections (Euclid Street/Katella Avenue, Disneyland Drive/Ball Road, Disneyland Drive/West Street/Katella Avenue, Harbor Boulevard/Ball Road, Anaheim Boulevard/Haster Street/Katella Avenue, State College Boulevard/Katella Avenue, State College Boulevard/Orangewood Avenue, State College Boulevard/The City Drive/Chapman Avenue, Orangewood Avenue/State Route [SR] 57 Southbound Ramps) and 1 ramp termini intersection (Orangewood Avenue/SR-57 Southbound Ramps). It was identified that these intersections would remain significant and unavoidable because of the infeasibility of mitigation measures due to high project cost or the inability to undertake right-of-way acquisitions as a matter of policy to preserve existing businesses, environmental constraints, or jurisdictional considerations. The Anaheim City Council adopted a Statement of Overriding Considerations with regard to these potential deficiencies. Additionally, SEIR No. 340 indicated no impacts would occur on intersections identified in the Congestion Management Program (CMP) for Orange County. The Traffic Impact Study Report for the Proposed Project found that it is expected to generate 3,229 new daily trips with 218 new trips occurring during the a.m. peak hour and 276 new trips during the p.m. peak hour. Based on the project land use and location, the following seven signalized intersections were analyzed to determine if there are any significant project impacts to the existing circulation system in the study area. • Anaheim Boulevard/Haster Street/Katella Avenue • Anaheim Boulevard/Disney Way • I-5 Southbound Off-Ramps/Disney Way • Manchester Avenue (I-5 Southbound Ramps)/Katella Avenue (CMP Intersection) • Anaheim Way (I-5 Northbound Ramps)/Katella Avenue (CMP Intersection) • Clementine Street/Katella Avenue • Harbor Boulevard/Katella Avenue (CMP Intersection) Intersection Capacity Utilization (ICU) analysis was performed for the a.m. and p.m. peak hours under four scenarios: • Existing 2016 conditions • Existing 2016 Plus Project conditions • Opening Year 2019 No Project conditions • Opening Year 2019 Plus Project conditions Based on the ICU analysis results for the four scenarios, it is observed that all of the study intersections, including the three CMP intersections, would operate at LOS C or better. The analysis also indicated that the project does not generate any significant impact to the study are under the Opening Year 2019 when compared to the No Project conditions; therefore, no traffic mitigations are required for the opening year analysis. The ARSP allows for up to 100 rooms per gross acre or 75 rooms per lot or parcel existing on the date of adoption of the ARSP, whichever is greater, or the equivalent of 600 square feet of visitor serving uses per hotel room. Therefore, the air quality analysis in SEIR No. 340 analyzed the operational impacts of the development of up to approximately 725 hotel rooms on the 7.0 acre property, which was subsequently reduced to 5.89 acres with the widening and realignment of Katella Avenue. The applicant proposes to demolish the existing Del Taco drive –through and surface parking lot and construct a 352-room, 12-story hotel and three restaurant pads totaling 15,641 square feet (equivalent to 27 rooms). As a result, the proposed project is equivalent to 379 rooms and falls under the maximum amount of development analyzed in SEIR No. 340. The proposed project would not result in any impacts beyond those identified in the previously certified SEIR No. 340. Any impacts are addressed by mitigation measures set forth in Mitigation Monitoring Plan No. 337, created for this project from Updated and Modified Mitigation Monitoring Program No. 85C (SEIR No. 340 for the Anaheim Resort Specific Plan No. 92-2). Project impacts would be less than significant. - 21- XVII. UTILITIES AND SERVICE SYSTEMS -- Would the Project: Environmental Issues Potentially Significant Impact Less Than Significant with Mitigation Less Than Significant Impact Impacts analyzed in SEIR No. 340 No New Impact No Impact a) Exceed wastewater treatment requirements of the applicable Regional Water Quality Control Board?      b) Require or result in the construction of new water or wastewater treatment facilities (including sewer (waste water) collection facilities) or expansion of existing facilities, the construction of which could cause significant environmental effects?      c) Require or result in the construction of new storm water drainage facilities or expansion of existing facilities, the construction of which could cause significant environmental effects?      d) Have sufficient water supplies available to serve the project (including large-scale developments as defined by Public Resources Code § 21151.9 and described in Question No. 20 of the City’s Environmental Information Form) from existing entitlements and resources, or are new or expanded entitlements needed?      e) Result in a determination by the wastewater treatment provider which serves or may serve the project that it has adequate capacity to serve the project's projected demand in addition to the provider's existing commitments?      f) Be served by a landfill with sufficient permitted capacity to accommodate the project's solid waste disposal needs?      g) Comply with Federal, State, and local statutes and regulations related to solid waste?      h) Result in a need for new systems or supplies, or substantial alterations related to electricity?      i) Result in a need for new systems or supplies, or substantial alterations related to natural gas?      j) Result in a need for new systems or supplies, or substantial alterations related to telephone service?      k) Result in a need for new systems or supplies, or substantial alterations related to television service/reception?      Narrative Summary: Impacts analyzed in SEIR No. 340/No new impacts. SEIR No. 340 analyzed the impacts to utilities and service systems related to the implementation of the Anaheim Resort Specific Plan No. 92-2. Refer to SEIR No. 340, - 22- Section 4.3.15. SEIR No. 340 identified that buildout of the ARSP would exceed capacities of existing water facilities; however, the projected water demand associated with buildout of the ARSP would be accommodated through existing and projected supplies. According to SEIR No. 340, the wastewater treatment requirements of the Santa Ana Regional Water Quality Control Board (RWQCB) would not be exceeded by buildout of the ARSP. SEIR No. 340 identified that buildout of the ARSP would increase sewage flows in existing sewer lines and trunks serving the area, resulting in several sewer lines becoming deficient; however, this impact would be mitigated to less than significant level. Additionally, it was determined that build out of the ARSP evaluated in SEIR No. 340 would increase sewage flows by approximately 323,656 gallons per day (gpd) in the PR District and 2.1 million gallons per day (mgd) in the C-R District and that these increases in sewage flow would be accommodated by available capacity at Orange County Sanitation District (OCSD) Treatment Plant No. 1. According to SEIR No. 340, buildout of the ARSP area would result in an increased demand for electricity. Compliance with the standard requirements and implementation of the proposed mitigation measures would reduce anticipated demand through conservation efforts. It is expected that the existing electrical distribution system and future planned improvements would adequately accommodate the anticipated demand. According to SEIR No. 340, buildout of the ARSP has the potential to worsen several existing deficiencies in the City’s storm drain system. However, participation in the City’s Master Plan of Storm Drains and related Infrastructure Improvement (Fee) Program would assist in mitigating existing and future storm drainage system deficiencies. According to SEIR No. 340, Southern California Gas Company (SCGC) indicated that natural gas service to the ARSP can be provided from an existing gas main that is accessible from various locations in the ARSP area. The service would be provided in accordance with the SCGC’s policies and extension rules on file with the California Public Utilities Commission. Buildout of the ARSP would generate an estimated 109,514 pounds of solid waste per day or approximately 19,986 tons of solid waste annually. Buildout of the ARSP would add approximately 19,986 tons of solid waste annually to existing solid waste facilities and capacity, which would impact the landfill system. However, the buildout of the ARSP could be accommodated within the permitted capacity of the County’s landfill capacity. In addition, once the Alpha Olinda Landfill closes in 2021, capacity would exist for buildout of the ARSP in the Frank R. Bowerman Landfill. AT&T would serve the ARSP area. According to SEIR No. 340, it was determined that AT&T can provide telephone, digital cable, and high-speed internet services and that the ARSP area can be served by Time Warner Cable with the existing cable resources available to the site. The ARSP allows for up to 100 rooms per gross acre or 75 rooms per lot or parcel existing on the date of adoption of the ARSP, whichever is greater, or the equivalent of 600 square feet of visitor serving uses per hotel room. Therefore, the air quality analysis in SEIR No. 340 analyzed the operational impacts of the development of up to approximately 725 hotel rooms on the 7.0 acre property, which was subsequently reduced to 5.89 acres with the widening and realignment of Katella Avenue. The applicant proposes to demolish the existing Del Taco drive –through and surface parking lot and construct a 352-room, 12-story hotel and three restaurant pads totaling 15,641 square feet (equivalent to 27 rooms). As a result, the proposed project is equivalent to 379 rooms and falls under the maximum amount of development analyzed in SEIR No. 340, and therefore, would not exceed the maximum demand for utilities and service systems previously analyzed. The proposed project would not result in any impacts beyond those identified in the previously certified SEIR No. 340. Any impacts are addressed by mitigation measures set forth in Mitigation Monitoring Plan No. 337, created for this project from Updated and Modified Mitigation Monitoring Program No. 85C (SEIR No. 340 for the Anaheim Resort Specific Plan No. 92-2). Project impacts would be less than significant. XVIII. MANDATORY FINDINGS OF SIGNIFICANCE -- Environmental Issues Potentially Significant Impact Less Than Significant with Mitigation Less Than Significant Impact Impacts analyzed in SEIR No. 340 No New Impact No Impact - 23- a) Does the project have the potential to degrade the quality of the environment, substantially reduce the habitat of a fish or wildlife species, cause a fish or wildlife population to drop below self-sustaining levels, threaten to eliminate a plant or animal community, reduce the number or restrict the range of a rare or endangered plant or animal or eliminate important examples of the major periods of California history or prehistory?      b) Does the project have Impacts that are individually limited, but cumulatively considerable? ("Cumulatively considerable" means that the incremental effects of a project are considerable when viewed in connection with the effects of past projects, the effects of other current projects, and the effects of probable future projects)?      c) Does the project have environmental effects which will cause substantial adverse effects on human beings, either directly or indirectly?      Narrative Summary: Impacts analyzed in SEIR No. 340/No new impacts. SEIR No. 340 analyzed the project’s impacts related to the implementation of the Anaheim Resort Specific Plan No. 92-2. The proposed project would not result in any impacts beyond those identified in the previously certified SEIR No. 340. Any impacts are addressed by mitigation measures set forth in Mitigation Monitoring Plan No. 337, created for this project from Updated and Modified Mitigation Monitoring Program No. 85C (SEIR No. 340 for the Anaheim Resort Specific Plan No. 92-2). Project impacts would be less than significant. - 24- References Assembly Bill 32: Global Warming Solutions Act. 2006. Available at: http://www.arb.ca.gov/cc/ab32/ab32.htm. Accessed on March 11, 2015. California Air Pollution Control Officers Association (CAPCOA). CEQA & Climate Change. January 2008. California Department of Conservation (DOC). Agricultural Preserves 2010 Status Report, Williamson Act Parcels, Orange County, California. Available at: http://www.conservation.ca.gov/dlrp/lca/stats_reports/Documents/2010%20Williamson%20Act%20Status%20Report. pdf DOC. Farmland Mapping and Monitoring Program Map for Orange County. 2010. DOC. Seismic Hazard Zones Map, Orange 7.5-Minute Quadrangle. April 15, 1998. California Department of Fish and Wildlife (CDFW). Natural Community Conservation Plan and Habitat Conservation Plan for the County of Orange Central and Coastal Subregion. 1996. Available at: https://www.wildlife.ca.gov/Conservation/Planning/NCCP/Plans/Orange-Coastal. Accessed on March 11, 2015. California Department of Toxic Substances Control. Cortese List. Available at: http://www.dtsc.ca.gov/SiteCleanup/Cortese_List.cfm. Accessed March 11, 2015. California Department of Transportation. Eligible (E) and Officially Designated (OD) [Scenic Highway] Routes. Available at: http://www.dot.ca.gov/hq/LandArch/scenic/cahisys.htm. Accessed on March 11, 2015. California Geologic Survey. Special Publication 117A, Guidelines for Evaluating and Mitigating Seismic Hazards in California. September 11, 2008. City of Anaheim (Anaheim). 2015 Urban Water Management Plan. June 2016. Anaheim. Anaheim Outdoors Connectivity Plan. April 2013. Anaheim. Citywide Historic Preservation Plan. May 2010. Available at: http://www.anaheim.net/planning/aRT/PlanCouncil-May2010.pdf. Accessed on March 11, 2015. Anaheim. General Plan Circulation Element Green Element: Mineral Resource Map Noise Element. Pg. N-9 Safety Element: Dam Inundation Map Anaheim. General Plan and Zoning Code Update Environmental Impact Report No. 330. May 25, 2004. Anaheim. Criteria for Preparation of Traffic Impact Studies. Anaheim. Municipal Code. 1974; updated as recently as February 2013. Anaheim. Sewer Capacity Map. Orange County Public Works. Drainage Area Management Plan. 2003. Orange County Transportation Authority. Orange County Congestion Management Plan. 2011. - 25- Senate Bill 375: Sustainable Communities and Climate Protection Act of 2008. 2008. Available at: http://www.leginfo.ca.gov/pub/07-08/bill/sen/sb_0351-0400/sb_375_bill_20080930_chaptered.pdf. Accessed on March 11, 2015. Southern California Air Quality Management District (SCAQMD). 2007 Air Quality Management Plan. Available at: http://www.aqmd.gov/home/library/clean-air-plans/air-quality-mgt-plan/2007-air-quality-management-plan . Accessed on March 11, 2015. SCAQMD. Rule 403, Fugitive Dust. Amended June 3, 2005. Available at: http://www.aqmd.gov/docs/default- source/rule-book/rule-iv/rule-403.pdf?sfvrsn=4 . Accessed on March 11, 2015. State of California, Governor’s Office of Planning and Research. CEQA and Climate Change: Addressing Climate Change Through California Environmental Quality Act (CEQA) Review. June 19, 2008. Pg. 4. United States Environmental Protection Agency (US EPA). Federal Water Pollution Control Act (known as the Clean Water Act). November 27, 2002. Walden and Associates. Preliminary Water Quality Management Plan (WQMP) Cambria Hotel and Suites by Choice Hotels. July 22, 2016 WSP/Parsons Brinckerhoff. Cambria Hotel and Suite Traffic Impact Study Report. November 2016 CAMBRIA HOTELS & SUITES DEV2016-00038, FSP2016-00004 UPDATED AND MODIFIED MITIGATION MONITORING PROGRAM NO. 85C MITIGATION MONITORING PLAN NO. 337 26 Terms and Definitions 1. Property Owner/Developer − Nexus Development Corporation 2. Environmental Equivalent/Timing − Any mitigation measure and timing thereof, subject to the approval of the City, which will have the same or superior result and will have the same or superior effect on the environment. The Planning and Building Department, in conjunction with any appropriate agencies or City departments, shall determine the adequacy of any proposed “environmental equivalent timing” and, if determined necessary, may refer said determination to the Planning Commission. Any costs associated with information required in order to make a determination of environmental equivalency/timing shall be borne by the property owner/developer. Staff time for reviews will be charged on a time and materials basis at the rate in the City’s adopted Fee Schedule. 3. Timing − This is the point where a mitigation measure must be monitored for compliance. In the case where multiple action items are indicated, it is the first point where compliance associated with the mitigation measure must be monitored. Once the initial action item has been complied with, no additional monitoring pursuant to the Mitigation Monitoring Plan will occur, as routine City practices and procedures will ensure that the intent of the measure has been complied with. For example, if the timing is “to be shown on approved building plans” subsequent to issuance of the building permit consistent with the approved plans will be final building and zoning inspections pursuant to the building permit to ensure compliance. 4. Responsibility for Monitoring − Shall mean that compliance with the subject mitigation measure(s) shall be reviewed and determined adequate by all departments listed for each mitigation measure. Outside public agency review is limited to those public agencies specified in the Mitigation Monitoring Plan which have permit authority in conjunction with the mitigation measure. 5. Ongoing Mitigation Measures − The mitigation measures that are designated to occur on an ongoing basis as part of this Mitigation Monitoring Plan will be monitored in the form of an annual letter from the property owner/developer in January of each year demonstrating how compliance with the subject measure(s) has been achieved. When compliance with a measure has been demonstrated for a period of one year, monitoring of the measure will be deemed to be satisfied and no further monitoring will occur. For measures that are to be monitored “Ongoing During Construction,” the annual letter will review those measures only while construction is occurring; monitoring will be discontinued after construction is complete. A final annual letter will be provided at the close of construction. 6. Building Permit − For purposes of this Mitigation Monitoring Plan, a building permit shall be defined as any permit issued for construction of a new building or structural expansion or modification of any existing building, but shall not include any permits required for interior tenant improvements or minor additions to an existing structure or building. CAMBRIA HOTELS & SUITES DEV2016-00038, FSP2016-00004 UPDATED AND MODIFIED MITIGATION MONITORING PROGRAM NO. 85C MITIGATION MONITORING PLAN NO. 337 27 Mitigation Measure Number Timing Measure Department Responsible for Monitoring Completion AESTHETICS MM 5.1-1 Prior to final site plan approval Prior to final site plan approval, the property owner/developer shall submit a shade and shadow analysis to the Planning and Building Department for review and approval demonstrating that the proposed structure(s) would avoid creating significant shade and shadow impacts on adjacent land uses to the maximum extent feasible. A significant shade and shadow impact would occur when outdoor active areas (e.g., outdoor eating areas, hotel/motel swimming pools, and residential front and back yards) or structures that include sensitive uses (e.g., residences) have windows that normally receive sunlight are covered by shadows for more than 50 percent of the sunlight hours. Planning and Building Department MM 5.1-2 Prior to issuance of building permits Prior to issuance of building permits, all plumbing or other similar pipes and fixtures located on the exterior of the building shall be shown on plans as fully screened from view of adjacent public rights-of-way and from adjacent properties by architectural devices and/or appropriate building materials. A note indicating that these improvements will be installed prior to final building and zoning inspections shall be specifically shown on the plans submitted for building permits. Planning and Building Department MM 5.1-3 Ongoing Ongoing, the property owner/developer shall be responsible for the removal of any on-site graffiti within 24 hours of its application. Planning and Building Department MM 5.1-4 Prior to Final Site Plan approval Prior to Final Site Plan approval, the location and configuration of all lighting fixtures including ground-mounted lighting fixtures utilized to accent buildings, landscape elements, or to illuminate pedestrian areas shall be shown on all Final Site Plans. All proposed surface parking area lighting fixtures shall be down-lighted with a maximum height of 12 feet adjacent to any residential properties. All lighting fixtures shall be shielded to direct lighting toward the area to be illuminated and away from adjacent residential property lines. Planning and Building Department CAMBRIA HOTELS & SUITES DEV2016-00038, FSP2016-00004 UPDATED AND MODIFIED MITIGATION MONITORING PROGRAM NO. 85C MITIGATION MONITORING PLAN NO. 337 28 Mitigation Measure Number Timing Measure Department Responsible for Monitoring Completion MM 5.1-5 Prior to final building and zoning inspections Prior to final building and zoning inspections, private streets within the Anaheim Resort Specific Plan area shall have street lights installed which are compatible with the design standards used for the public streets as determined by the Public Utilities Department. Public Utilities Department MM 5.1-6 Prior to final building and zoning inspections Prior to final building and zoning inspections, root and sidewalk barriers shall be provided for trees within seven feet of public sidewalks. Planning and Building Department MM 5.1-7 Prior to final building and zoning inspections Prior to final building and zoning inspections, the property owner/developer shall submit to the Planning and Building Department a letter from a licensed landscape architect certifying that all landscaping and irrigation systems have been installed in accordance with landscaping plans approved in connection with the Final Site Plan. Planning and Building Department MM 5.1-8 Ongoing Ongoing, all on-site non-Public Realm landscaping and irrigation systems, and Public Realm landscaping and irrigation systems, within area in which dedication has not been accepted by the City, shall be maintained by the property owner/developer, in compliance with City standards. Planning and Building Department MM 5.1-9 Ongoing Ongoing, any tree planted within the Setback Realm shall be replaced in a timely manner in the event that it is removed, damaged, diseased and/or dead. Planning and Building Department MM 5.1-10 Ongoing Ongoing, a licensed arborist shall be hired by the property owner/developer to be responsible for all tree trimming. Planning and Building Department MM 5.1-11 Prior to issuance of each building permits Prior to issuance of each building permits, unless records indicate previous payment, a fee for street tree purposes shall be paid or cause to be paid to the City of Anaheim based on the length of street frontage in an amount as established by City Council resolution or credit against the fee given for City authorized improvements installed by the property owner/developer. Planning and Building Department CAMBRIA HOTELS & SUITES DEV2016-00038, FSP2016-00004 UPDATED AND MODIFIED MITIGATION MONITORING PROGRAM NO. 85C MITIGATION MONITORING PLAN NO. 337 29 Mitigation Measure Number Timing Measure Department Responsible for Monitoring Completion MM 5.1-12 Prior to issuance of each building permit Prior to issuance of each building permit, all air conditioning facilities and other roof and ground-mounted equipment shall be shown on plans as shielded from public view and the sound buffered to comply with City of Anaheim noise ordinances from any adjacent residential or transient- occupied properties. A note indicating that these improvements shall be installed prior to final building and zoning inspections shall be specifically shown on the plans submitted for building permits. Planning and Building Department MM 5.1-13 Prior to Final Site Plan approval Prior to Final Site Plan approval, plans shall show that the rear elevations of buildings visible from off-site areas shall be architecturally accented to portray a finished look. Planning and Building Department MM 5.1-14 Prior to Final Site Plan approval Prior to Final Site Plan approval, plans shall show that no shuttle/bus/vehicular drop-off areas shall be permitted in hotel/motel or vacation resort front setback area. Planning and Building Department AIR QUALITY MM 5.2-1 Ongoing during project operation Ongoing during project operation, the property owner/developer shall implement measures to reduce emissions to the extent practical, schedule goods movements for off-peak traffic hours, and use clean fuel for vehicles and other equipment, as practicable. Planning and Building Department MM 5.2-2 Prior to the issuance of each building permit Prior to the issuance of each building permit, the property owner/developer shall submit evidence that low emission paints and coatings are utilized in the design and construction of buildings, in compliance with SCAQMD regulations. The information shall be denoted on the project plans and specifications. The property owner/developer shall submit an architectural coating schedule and calculations demonstrating that VOC emissions from architectural coating operations would not exceed 75 pounds per day averaged over biweekly periods. The calculations shall show, for each coating, the surface area to be coated, gallons (or liters) of coating per unit surface area, and VOC content per gallon (or liter). The property owner/developer shall also implement the following to limit emissions from Planning and Building Department CAMBRIA HOTELS & SUITES DEV2016-00038, FSP2016-00004 UPDATED AND MODIFIED MITIGATION MONITORING PROGRAM NO. 85C MITIGATION MONITORING PLAN NO. 337 30 Mitigation Measure Number Timing Measure Department Responsible for Monitoring Completion architectural coatings and asphalt usage: a. Use non-solvent-based coatings on buildings, wherever appropriate; b. Use solvent-based coatings, where they are necessary. MM 5.2-3 Ongoing during construction Ongoing during construction, the property owner/developer shall implement measures to reduce construction-related air quality impacts. These measures shall include, but are not limited to: a. Normal wetting procedures (at least twice daily) or other dust palliative measures shall be followed during earth-moving operations to minimize fugitive dust emissions, in compliance with the City of Anaheim Municipal Code including application of chemical soil stabilizers to exposed soils after grading is completed and replacing ground cover in disturbed areas as quickly as practicable. b. For projects where there is excavation for subterranean facilities (such as parking) on-site haul roads shall be watered at least every two hours or the on-site haul roads shall be paved. c. Enclosing, covering, watering twice daily, or applying approved soil binders, according to manufacturer’s specification, to exposed piles. d. Roadways adjacent to the project shall be swept and cleared of any spilled export materials at least twice a day to assist in minimizing fugitive dust; and, haul routes shall be cleared as needed if spills of materials exported from the project site occur. e. Where practicable, heavy duty construction equipment shall be kept onsite when not in operation to minimize exhaust emissions associated with vehicles repetitiously entering and exiting the project site. f. Trucks importing or exporting soil material and/or debris shall be covered prior to entering public streets. Planning and Building Department CAMBRIA HOTELS & SUITES DEV2016-00038, FSP2016-00004 UPDATED AND MODIFIED MITIGATION MONITORING PROGRAM NO. 85C MITIGATION MONITORING PLAN NO. 337 31 Mitigation Measure Number Timing Measure Department Responsible for Monitoring Completion g. Taking preventive measures to ensure that trucks do not carry dirt on tires onto public streets, including treating onsite roads and staging areas. h. Preventing trucks from idling for longer than 2 minutes. i. Manually irrigate or activate irrigation systems necessary to water and maintain the vegetation as soon as planting is completed. j. Reduce Traffic speeds on all unpaved road surfaces to 15 miles per hour or less. k. Suspend all grading operations when wind speeds (as instantaneous gust) exceed 25 miles per hour and during first and second stage smog alerts. l. Comply with SCAQMD Rule 402, which states that no dust impacts offsite are sufficient to be called a nuisance, and SCAQMD Rule 403, which restricts visible emissions from construction. m. Use low emission mobile construction equipment (e.g., tractors, scrapers, dozers, etc.) where practicable. n. Utilize existing power sources (e.g., power poles) or clean-fuel generators rather than temporary power generators, where practicable. o. Maintain construction equipment engines by keeping them properly tuned. p. Use low sulfur fuel for equipment, to the extent practicable. MM 5.2-4 Prior to issuance of each grading permit (for Import/Export Plan) and prior to issuance of demolition permit (for Prior to issuance of each grading permit (for Import/Export Plan) and prior to issuance of demolition permit (for Demolition Plan), the property owner/developer shall submit Demolition and Import/Export plans. The plans shall include identification of offsite locations for materials export from the project and options for disposal of excess material. These options may Planning and Building Department CAMBRIA HOTELS & SUITES DEV2016-00038, FSP2016-00004 UPDATED AND MODIFIED MITIGATION MONITORING PROGRAM NO. 85C MITIGATION MONITORING PLAN NO. 337 32 Mitigation Measure Number Timing Measure Department Responsible for Monitoring Completion Demolition Plan) include recycling of materials onsite, sale to a soil broker or contractor, sale to a project in the vicinity or transport to an environmentally cleared landfill, with attempts made to move it within Orange County. The property owner/developer shall offer recyclable building materials, such as asphalt or concrete for sale or removal by private firms or public agencies for use in construction of other projects, if not all can be reused on the project site. MM 5.2-5 Prior to the issuance of each building permit Prior to the issuance of each building permit, the property owner/developer shall comply with all SCAQMD offset regulations and implementation of Best Available Control Technology (BACT) and Best Available Retrofit Control Technology (BARCT) for any new or modified stationary source. Copies of permits shall be given to the Planning and Building Department. Planning and Building Department MM 5.2-6 Prior to the issuance of each building permit Prior to the issuance of each building permit, the property owner/developer shall implement, and demonstrate to the City, measures that are being taken to reduce operation-related air quality impacts. These measures may include, but are not limited to the following: a. Improve thermal integrity of structures and reduced thermal load through use of automated time clocks or occupant sensors. b. Incorporate efficient heating and other appliances. c. Incorporate energy conservation measures in site orientation and in building design, such as appropriate passive solar design. d. Use drought-resistant landscaping wherever feasible to reduce energy used in pumping and transporting water. e. To the extent feasible, provide daycare opportunities for employees or participate in a joint development daycare center f. Install facilities for electric vehicle recharging, unless it is demonstrated that the technology for these facilities or availability of the equipment current at the time makes this installation infeasible. Planning and Building Department CAMBRIA HOTELS & SUITES DEV2016-00038, FSP2016-00004 UPDATED AND MODIFIED MITIGATION MONITORING PROGRAM NO. 85C MITIGATION MONITORING PLAN NO. 337 33 Mitigation Measure Number Timing Measure Department Responsible for Monitoring Completion BIOLOGICAL RESOURCES MM 5.3-1 Prior to the issuance of a demolition permit, grading permit, or building permit, whichever occurs first Prior to the issuance of a demolition permit, grading permit, or building permit, whichever occurs first, a survey for active raptor nests shall be conducted by a qualified Biologist and submitted to the Planning and Building Department 30 days prior to commencement of any demolition or construction activities during the raptor nesting season (February 1 to June 30) and within 500 feet of a fan palm, juniper, or canary island pine. Should an active nest be identified, restrictions defined by a qualified Biologist will be placed on construction activities in the vicinity of any active nest observed until the nest is no longer active, as determined by a qualified Biologist. These restrictions may include a 300- to 500-foot buffer zone designated around a nest to allow construction to proceed while minimizing disturbance to the active nest. Once the nest is no longer active, construction can proceed within the buffer zone. Planning and Building Department MM 5.3-2 Prior to the issuance of a demolition permit, grading permit, or building permit, whichever occurs first Prior to the issuance of a demolition permit, grading permit, or building permit, whichever occurs first, a letter detailing the proposed schedule for vegetation removal activities shall be submitted to the Planning and Building Department, verifying that removal shall take place between August 1 and February 28 to avoid the bird nesting season. This would ensure that no active nests would be disturbed. If this is not feasible, then a qualified Biologist shall inspect any trees which would be impacted prior to demolition, grading or construction activities to ensure no nesting birds are present. If a nest is present, then appropriate minimization measures shall be developed by the Biologist. Planning and Building Department CULTURAL RESOURCES MM 5.4-1 Prior to issuance of each grading permit Prior to issuance of each grading permit, the property owner/developer shall submit a letter identifying the certified archaeologist that has been hired to ensure that the following actions are implemented: a. The archaeologist must be present at the pre-grading conference in Planning and Building Department CAMBRIA HOTELS & SUITES DEV2016-00038, FSP2016-00004 UPDATED AND MODIFIED MITIGATION MONITORING PROGRAM NO. 85C MITIGATION MONITORING PLAN NO. 337 34 Mitigation Measure Number Timing Measure Department Responsible for Monitoring Completion order to establish procedures for temporarily halting or redirecting work to permit the sampling, identification, and evaluation of artifacts if potentially significant artifacts are uncovered. If artifacts are uncovered and determined to be significant, the archaeological observer shall determine appropriate actions in cooperation with the property owner/developer for exploration and/or salvage. b. Specimens that are collected prior to or during the grading process will be donated to an appropriate educational or research institution. c. Any archaeological work at the site shall be conducted under the direction of the certified archaeologist. If any artifacts are discovered during grading operations when the archaeological monitor is not present, grading shall be diverted around the area until the monitor can survey the area. d. A final report detailing the findings and disposition of the specimens shall be submitted to the City Engineer. Upon completion of the grading, the archaeologist shall notify the City as to when the final report will be submitted. MM 5.4-2 Prior to issuance of each grading permit Prior to issuance of each grading permit, the property owner/developer shall submit a letter identifying the certified paleontologist that has been hired to ensure that the following actions are implemented: a. The paleontologist must be present at the pre-grading conference in order to establish procedures to temporarily halt or redirect work to permit the sampling, identification, and evaluation of fossils if potentially significant paleontological resources are uncovered. If artifacts are uncovered and found to be significant, the paleontological observer shall determine appropriate actions in cooperation with the property owner/developer for exploration and/or salvage. b. Specimens that are collected prior to or during the grading process will Planning and Building Department CAMBRIA HOTELS & SUITES DEV2016-00038, FSP2016-00004 UPDATED AND MODIFIED MITIGATION MONITORING PROGRAM NO. 85C MITIGATION MONITORING PLAN NO. 337 35 Mitigation Measure Number Timing Measure Department Responsible for Monitoring Completion be donated to an appropriate educational or research institution. c. Any paleontological work at the site shall be conducted under the direction of the certified paleontologist. If any fossils are discovered during grading operations when the paleontological monitor is not present, grading shall be diverted around the area until the monitor can survey the area. MM 5.4-3 Prior to approval of a final site plan for properties that contain a structure over 45 years old Prior to approval of a final site plan for properties that contain a structure over 45 years old, property owners/developers shall submit to the Planning and Building Department, Planning Services Division, documentation to verify the presence/absence of historic resources. On properties where resources are identified, such documentation shall provide a detailed mitigation plan, including a monitoring program and recovery and/or in situ preservation plan, based on the recommendations of a qualified specialist. Planning and Building Department GEOLOGY AND SOILS MM 5.5-1 Prior to issuance of each building permit Prior to issuance of each building permit, the property owner/developer shall submit to the Planning and Building Department, Building Services Division for review and approval, detailed foundation design information for the subject building(s), prepared by a civil engineer, based on recommendations by a geotechnical engineer. Planning and Building Department MM 5.5-2 Prior to issuance of each foundation permit Prior to issuance of each foundation permit, the property owner/developer shall submit a report prepared by a geotechnical engineer to the Planning and Building Department, Building Services Division for review and approval, which shall investigate the subject foundation excavations to determine if soft layers are present immediately beneath the footing site and to ensure that compressibility does not underlie the footing. Planning and Building Department MM 5.5-3 Prior to issuance of each building permit Prior to issuance of each building permit, the property owner/developer shall submit plans to the Planning Department, Building Services Division for review and approval showing that the proposed structure has been analyzed Planning and Building Department CAMBRIA HOTELS & SUITES DEV2016-00038, FSP2016-00004 UPDATED AND MODIFIED MITIGATION MONITORING PROGRAM NO. 85C MITIGATION MONITORING PLAN NO. 337 36 Mitigation Measure Number Timing Measure Department Responsible for Monitoring Completion for earthquake loading and designed according to the most recent seismic standards in the California Building Code adopted by the City of Anaheim. MM 5.5-4 Prior to the final building and zoning inspection for a hotel/motel Prior to the final building and zoning inspection for a hotel/motel, the property owner/developer shall submit an earthquake emergency response plan for review and approval by the Fire Department. The plan shall require posted notices in all hotel rooms on earthquake safety procedures and incorporate ongoing earthquake training for hotel staff to the satisfaction of the Fire Department. Fire Department MM 5.5-5 Ongoing during grading activities Ongoing during grading activities, the property owner/developer shall implement standard practices for all applicable codes and ordinances to prevent erosion to the satisfaction of the Planning and Building Department, Building Services Division. Planning and Building Department MM 5.5-6 Prior to issuance of building or grading permits Prior to issuance of building or grading permits, the property owner/developer shall submit to the Planning and Building Department, Building Services Division geologic and geotechnical investigations in areas of potential seismic or geologic hazards and provide a note on plans that all grading operations will be conducted in conformance with the recommendations contained in the applicable geotechnical investigation. Planning and Building Department HAZARDS AND HAZARDOUS MATERIALS MM 5.7-3 Ongoing during remediation all remediation activities of surface or subsurface contamination not related to USTs Ongoing during remediation all remediation activities of surface or subsurface contamination not related to USTs, conducted on behalf of the property owner/developer, shall be overseen by the Orange County Health Care Agency (OCHCA). Information on subsurface contamination from USTs shall be provided to the Public Utilities Department, Environmental Services Division. Santa Ana Regional Water Quality Control Board (SARWQCB) with a copy to Planning & Building. Note: Per a memo dated October 22, 2014 from the Public Utilities Department, as of July 1, 2014, the Environmental Services Division of the Fire Department Public Utilities Department Planning & Building CAMBRIA HOTELS & SUITES DEV2016-00038, FSP2016-00004 UPDATED AND MODIFIED MITIGATION MONITORING PROGRAM NO. 85C MITIGATION MONITORING PLAN NO. 337 37 Mitigation Measure Number Timing Measure Department Responsible for Monitoring Completion Public Utilities Department is no longer responsible for overseeing the cleanup of new UST cases, and the responsibility has been delegated to the Santa Ana Regional Water Quality Control Board (SARWQCB). However, the Anaheim Fire Department will still be responsible for overseeing the removal of USTs. (amended February 26, 2015). MM 5.7-6 Ongoing during project demolition and construction Ongoing during project demolition and construction, in the event that hazardous waste, including asbestos, is discovered during site preparation or construction, the property owner/developer shall ensure that the identified hazardous waste and/or hazardous material are handled and disposed of in the manner specified by the State of California Hazardous Substances Control Law (Health and Safety Code, Division 20, Chapter 6.5), and according to the requirements of the California Administrative Code, Title 30, Chapter 22. Fire Department HYDROLOGY AND WATER QUALITY MM 5.8-1 Prior to issuance of the first grading or building permit, whichever occurs first Prior to issuance of the first grading or building permit, whichever occurs first, the property owner/developer shall submit a Master Drainage and Runoff Management Plan (MDRMP) for review and approval by the Public Works Department, Development Services Division and Orange County (OC) Public Works/OC Engineering. The Master Plan shall include, but not be limited to, the following items: a. Backbone storm drain layout and pipe size, including supporting hydrology and hydraulic calculations for storms up to and including the 100-year storm; and, b. A delineation of the improvements to be implemented for control of project-generated drainage and runoff. Public Works Department MM 5.8-2 Prior to issuance of a grading permit for sites that disturb more than one (1) acre of soil Prior to issuance of a grading permit for sites that disturb more than one (1) acre of soil, the property owner/developer shall obtain coverage under the NPDES Statewide Industrial Stormwater Permit for General Construction Activities from the State Water Resources Control Board. Evidence of attainment shall be submitted to the Planning and Building Department, Planning and Building Department CAMBRIA HOTELS & SUITES DEV2016-00038, FSP2016-00004 UPDATED AND MODIFIED MITIGATION MONITORING PROGRAM NO. 85C MITIGATION MONITORING PLAN NO. 337 38 Mitigation Measure Number Timing Measure Department Responsible for Monitoring Completion Building Services Division. MM 5.8-3 Ongoing during project operations Ongoing during project operations, the property owner/developer shall provide for the following: cleaning of all paved areas not maintained by the City of Anaheim on a monthly basis, including, but not limited to, private streets and parking lots. The use of water to clean streets, paved areas, parking lots, and other areas and flushing the debris and sediment down the storm drains shall be prohibited. Planning and Building Department MM 5.8-4 Prior to each final building and zoning inspection Prior to each final building and zoning inspection, the property owner/developer shall submit a letter from a licensed landscape architect to the City certifying that the landscape installation and irrigation systems have been installed as specified in the approved landscaping and irrigation plans. Planning and Building Department MM 5.8-5 Prior to final building and zoning inspection Prior to final building and zoning inspection, the property owner/developer shall install piping on-site with project water mains so that reclaimed water may be used for landscape irrigation, if and when it becomes available. Public Utilities Department MM 5.8-6 Prior to issuance of building permits Prior to issuance of building permits, the property owner/developer shall provide written evidence that all storm drain, sewer, and street improvement plans shall be designed and constructed to the satisfaction of the City Engineer. Public Works Department NOISE 5.10-1 Ongoing during construction, Ongoing during construction, the property owner/developer shall ensure that all internal combustion engines on construction equipment and trucks are fitted with properly maintained mufflers. Planning and Building Department CAMBRIA HOTELS & SUITES DEV2016-00038, FSP2016-00004 UPDATED AND MODIFIED MITIGATION MONITORING PROGRAM NO. 85C MITIGATION MONITORING PLAN NO. 337 39 Mitigation Measure Number Timing Measure Department Responsible for Monitoring Completion 5.10-2 Prior to approval of each final site plan Prior to approval of each final site plan, the property owner/developer shall submit a noise study prepared by a certified acoustical engineer to the satisfaction of the Building Division Manager identifying whether noise attenuation is required and defining the attenuation measures and specific performance requirements, if warranted, to comply with the Uniform Building Code and Sound Pressure Level Ordinance. Ultimate noise attenuation requirements, if any, shall depend on the final location of such buildings and noise-sensitive uses inside and surrounding the buildings. Attenuation measures shall be implemented by the property owner/developer prior to final building and zoning inspections. Planning and Building Department 5.10-3 Prior to issuance of each building permit Prior to issuance of each building permit, for structures that are adjacent to noise-sensitive areas such as residences, the property owner/developer shall ensure that all mechanical ventilation units are shown on plans and installed in compliance with Sound Pressure Level Ordinance. Planning and Building Department 5.10-5 Prior to issuance of each building permit Prior to issuance of each building permit, a note shall be provided on building plans indicating that during construction, the property owner/developer shall install and maintain specially designed construction barriers at the project perimeter areas. The construction sound barriers shall be a minimum height of 8 feet with a minimum surface weight of 1.25 pounds per square foot or a minimum Sound Transmission Class (STC) rating of 25. The structure shall be a continuous barrier. Gates and other entry doors shall be constructed with suitable mullions, astragals, seals, or other design techniques to minimize sound leakage when in the closed position. Access doors should be self closing where feasible. Vision ports are permissible providing they are filled with an acceptable solid vision product. Planning and Building Department 5.10-6 Ongoing during construction and project operation Ongoing during construction and project operation, pressure washing operations for purposes of building repair and maintenance due to graffiti or other aesthetical considerations shall be limited to daytime hours of operation between 7:00 AM and 8:00 PM. Planning and Building Department CAMBRIA HOTELS & SUITES DEV2016-00038, FSP2016-00004 UPDATED AND MODIFIED MITIGATION MONITORING PROGRAM NO. 85C MITIGATION MONITORING PLAN NO. 337 40 Mitigation Measure Number Timing Measure Department Responsible for Monitoring Completion 5.10-7 Ongoing during construction and project operation Ongoing during construction and project operation, sweeping operations in the parking facilities and private on-site roadways shall be performed utilizing sweeping/scrubbing equipment which operate at a level measured not greater than 60 dBA at the nearest adjacent property line. Planning and Building Department 5.10-9 Prior to issuance of each building permit Prior to issuance of each building permit, the property owner/developer shall present plans and calculations to the Planning Department, Building Division to demonstrate that noise levels would be less than 65 dBA CNEL for outdoor use areas (including dining patios, pools, playgrounds, or outdoor gathering areas). This requirement can be accomplished through shielding areas behind buildings or the construction of a noise barrier. Planning and Building Department 5.10-10 Prior to issuance of each building permit Prior to issuance of each building permit, the property owner/developer shall present plans and calculations to the Planning and Building Department, Building Division to demonstrate that noise levels from planned mechanical ventilation equipment, loading docks, trash compactors, and other proposed on-site noise sources are designed to meet the City’s 60 dBA Sound Pressure Levels standard at the property line, and not create a noise increase greater than 5 dBA over existing ambient noise at the nearest noise sensitive receptor, whichever is more restrictive. Planning and Building Department 5.10-12 Prior to issuance of each building permit if pile driving and blasting is anticipated during construction Prior to issuance of each building permit if pile driving and blasting is anticipated during construction, a noise and vibration analysis must be prepared and submitted to the Planning and Building Department, Building Division, to assess and mitigate potential noise and vibration impacts related to these activities. Planning and Building Department PUBLIC SERVICES 5.12-1 Prior to the approval of each Final Site Plan and issuance of each building permit Prior to the approval of each Final Site Plan and issuance of each building permit, the property owner/developer shall submit plans to the Police Department for review and approval for safety, accessibility, crime prevention, and security provisions during both the construction and operative phases for the purpose of incorporating safety measures in the project design Police Department CAMBRIA HOTELS & SUITES DEV2016-00038, FSP2016-00004 UPDATED AND MODIFIED MITIGATION MONITORING PROGRAM NO. 85C MITIGATION MONITORING PLAN NO. 337 41 Mitigation Measure Number Timing Measure Department Responsible for Monitoring Completion including the concept of crime prevention through environmental design (e.g., building design, circulation, site planning, and lighting of parking structures and parking areas). 5.12-2 Prior to the issuance of each building permit for a parking structure Prior to the issuance of each building permit for a parking structure, the property owner/developer shall submit plans to the Police Department for review and approval indicating the provision of closed circuit television monitoring and recording or other substitute security measures as may be approved by the Police Department. Said measures shall be implemented prior to final building and zoning inspections. Police Department 5.12-3 Ongoing during project operation Ongoing during project operation, the property owner/developer shall provide private security on the premises to maintain adequate security for the entire project subject to review and approval of the Police Department. The use of security patrols and electronic security devices (i.e., video monitors) should be considered to reduce the potential for criminal activity in the area. Police Department 5.12-4 Prior to issuance of each building permit Prior to issuance of each building permit, the project design shall include parking lots and parking structures with controlled access points to limit ingress and egress if determined to be necessary by the Police Department, and shall be subject to the review and approval of the Police Department. Police Department 5.12-5 Prior to commencement of structural framing on each parcel or lot Prior to commencement of structural framing on each parcel or lot, onsite fire hydrants shall be installed and charged by the property owner/developer as required and approved by the Fire Department. Fire Department 5.12-6 Prior to issuance of each grading permit Prior to issuance of each grading permit, the property owner/developer shall submit an emergency fire access plan to the Fire Department for review and approval to ensure that service to the site is in accordance with Fire Department service requirements. Fire Department CAMBRIA HOTELS & SUITES DEV2016-00038, FSP2016-00004 UPDATED AND MODIFIED MITIGATION MONITORING PROGRAM NO. 85C MITIGATION MONITORING PLAN NO. 337 42 Mitigation Measure Number Timing Measure Department Responsible for Monitoring Completion 5.12-7 Prior to issuance of each building permit; to be implemented prior to the final building and zoning inspection Prior to issuance of each building permit; to be implemented prior to the final building and zoning inspection, plans shall indicate that all buildings, exclusive of parking structures, shall have sprinklers installed by the property owner/developer in accordance with the Anaheim Municipal Code. Said sprinklers shall be installed prior to each final building and zoning inspection. Fire Department 5.12-8 Prior to issuance of each building permit Prior to issuance of each building permit, plans shall be submitted to ensure that development is in accordance with the City of Anaheim Fire Department Standards, including: a. Overhead clearance shall not be less than 14 feet for the full width of access roads. b. Bridges and underground structures to be used for Fire Department access shall be designed to support Fire Department vehicles weighing 75,000 pounds. c. All underground tunnels shall have sprinklers. Water supplies are required at all entrances. Standpipes shall also be provided when determined to be necessary by the Fire Department. d. Adequate off-site public fire hydrants contiguous to the Specific Plan area and onsite private fire hydrants shall be provided by the property owner/developer. The precise number, types, and locations of the hydrants shall be determined during building permit review. Hydrants are to be a maximum of 400 feet apart. e. A minimum residual water pressure of 20 psi shall remain in the water system. Flow rates for public parking facilities shall be set at 1,000 to 1,500 gpm. Fire Department 5.12-9 Prior to issuance of the first building permit Prior to issuance of the first building permit, the property owner/developer shall enter into an agreement recorded against the property with the City of Anaheim to pay or cause to be paid their fair share of the funding to Fire Department CAMBRIA HOTELS & SUITES DEV2016-00038, FSP2016-00004 UPDATED AND MODIFIED MITIGATION MONITORING PROGRAM NO. 85C MITIGATION MONITORING PLAN NO. 337 43 Mitigation Measure Number Timing Measure Department Responsible for Monitoring Completion accommodate the following, which will serve the Anaheim Resort Specific Plan area: a. One additional fire truck company. b. One additional paramedic company. c. Modifications to existing fire stations to accommodate the additional fire units, additional manpower, equipment and facilities. d. A vehicle equipped with specialty tools and equipment to enable the Fire Department to provide heavy search and rescue response capability. e. A medical triage vehicle/trailer, equipped with sufficient trauma dressings, medical supplies, stretchers, etc., to handle 1,000 injured persons, and an appropriate storage facility. The determination of the allocable share of costs attributable to the property owner/developer shall be based on an apportionment of the costs of such equipment/facilities among property owners/developers in the Hotel Circle Specific Plan Area, the Disneyland Resort Specific Plan Area and the Anaheim Resort Specific Plan Area or the otherwise defined service area, as applicable, depending on the area served. Note: To implement this mitigation measure, the City has adopted the Fire Protection Facilities and Paramedic Services Impact Fee Program. Compliance with this Program by the property owner/developer (per Ordinance No. 5496 and Resolution No. 95R-73 dated May 16, 1995) shall satisfy the requirements of this Mitigation Measure, or the City may enter into alternative financing arrangements. CAMBRIA HOTELS & SUITES DEV2016-00038, FSP2016-00004 UPDATED AND MODIFIED MITIGATION MONITORING PROGRAM NO. 85C MITIGATION MONITORING PLAN NO. 337 44 Mitigation Measure Number Timing Measure Department Responsible for Monitoring Completion 5.12-10 Prior to each final building and zoning inspection Prior to each final building and zoning inspection, the property owner/developer shall place emergency telephone service numbers in prominent locations as approved by the Fire Department. Fire Department 5.12-11 Prior to issuance of each building permit Prior to issuance of each building permit, the property owner/developer shall submit a Construction Fire Protection Plan to the Fire Department for review and approval detailing accessibility of emergency fire equipment, fire hydrant location, and any other construction features required by the Fire Marshal. The property owner/developer shall be responsible for securing facilities acceptable to the Fire Department and hydrants shall be operational with required fire flow. Fire Department 5.12-12 Prior to the approval of each Final Site Plan and prior to the issuance of each building permit Prior to the approval of each Final Site Plan and prior to the issuance of each building permit, plans shall be reviewed and approved by the Fire Department as being in conformance with the Uniform Fire Code. Fire Department 5.12-13 Prior to the placement of building materials on a building site Prior to the placement of building materials on a building site, an all-weather road shall be provided from the roadway system to and on the construction site and for fire hydrants at all times, as required by the Fire Department. Such routes shall be paved or, subject to the approval of the Fire Department, shall otherwise provide adequate emergency access. Every building constructed must be accessible to Fire Department apparatus. The width and radius of the driving surface must meet the requirements of Section 10.204 of the Uniform Fire Code, as adopted by the City of Anaheim. Fire Department 5.12-14 Prior to approval of building plans Prior to approval of building plans, the property owner/developer shall provide written evidence to the satisfaction of the Fire Department that all lockable pedestrian and/or vehicular access gates shall be equipped with “knox box” devices as required and approved by the Fire Department. Fire Department 5.12-15 Prior to approval of on-site water plans Prior to approval of on-site water plans, unless each commercial building is initially connected to separate fire services, an unsubordinated covenant satisfactory to the City Attorney’s Office shall be recorded prohibiting any Fire Department CAMBRIA HOTELS & SUITES DEV2016-00038, FSP2016-00004 UPDATED AND MODIFIED MITIGATION MONITORING PROGRAM NO. 85C MITIGATION MONITORING PLAN NO. 337 45 Mitigation Measure Number Timing Measure Department Responsible for Monitoring Completion individual sale of buildings until separate fire services are installed in the building(s) subject to the sale. 5.12-16 Prior to approval of water improvement plans Prior to approval of water improvement plans, the water supply system shall be designed by the property owner/developer to provide sufficient fire flow pressure and storage for the proposed land use and fire protection services in accordance with Fire Department requirements. Fire Department 5.12-17 Prior to issuance of each building permit Prior to issuance of each building permit, the property owner/developer shall provide proof of compliance with Government Code Section 53080 (Schools). Planning and Building Department 5.12-19 Prior to the issuance of a building permit Prior to the issuance of a building permit, the property owner/developer shall comply with the Anaheim Municipal Code, Section 17.08.385, Public Library Facilities Services Areas – Payment of Fees Required. Planning and Building Department TRANSPORTATION AND TRAFFIC 5.14-2 Prior to issuance of the first building permit for each building Prior to issuance of the first building permit for each building, the property owner/developer shall pay the appropriate Traffic Signal Assessment Fees and Transportation Impact and Improvement Fees to the City of Anaheim in amounts determined by the City Council Resolution in effect at the time of issuance of the building permit with credit given for City-authorized improvements provided by the property owner/developer. The property owner shall also participate in all applicable reimbursement or benefit districts, which have been established. Public Works Department 5.14-3 Prior to approval of the first final subdivision map or issuance of the first building permit, whichever occurs first Prior to approval of the first final subdivision map or issuance of the first building permit, whichever occurs first, the property owner/developer shall irrevocably offer for dedication (with subordination of easements), including necessary construction easements, the ultimate arterial highway right(s)-of- way adjacent to their property as shown in the Circulation Element of the Anaheim General Plan. Public Works Department CAMBRIA HOTELS & SUITES DEV2016-00038, FSP2016-00004 UPDATED AND MODIFIED MITIGATION MONITORING PROGRAM NO. 85C MITIGATION MONITORING PLAN NO. 337 46 Mitigation Measure Number Timing Measure Department Responsible for Monitoring Completion 5.14-4 Prior to the final building and zoning inspection Prior to the final building and zoning inspection, the property owner shall join and financially participate in a clean fuel shuttle program such as the Anaheim Resort Transit system, and shall participate in the Anaheim Transportation Network in conjunction with the on-going operation of the project. The property owner shall also record a covenant on the property that requires participation in these programs ongoing during project operation. The form of the covenant shall be approved by the City Attorney’s Office prior to recordation. Public Works Department 5.14-5 Prior to the issuance of grading permits Prior to the issuance of grading permits, the property owner/developer shall provide to the City of Anaheim Public Works Department a plan to coordinate rideshare services for construction employees with the Anaheim Transportation Network (ATN) for review and a approval and shall implement ATN recommendations to the extent feasible. Public Works Department 5.14-6 Prior to the issuance of each building permit for a hotel development that exceeds 100 rooms per gross acre within the Commercial Recreation District within the Convention Center Medium density category Prior to the issuance of each building permit for a hotel development that exceeds 100 rooms per gross acre within the Commercial Recreation (C-R) District (Development Area 1) within the Convention Center (CC) Medium density category, the property owner shall record a covenant on the property requiring that ongoing during project implementation, the property owner/developer shall implement TDM measures sufficient to reduce the actual trip generation from the development to no more than the trips assumed by the City’s traffic model. The form of the covenant shall be approved by the City Attorney’s Office. Public Works Department 5.14-7 Ongoing during construction Ongoing during construction, if the Anaheim Police Department or the Anaheim Traffic Management Center (TMC) personnel are required to provide temporary traffic control services, the property owner/developer shall reimburse the City, on a fair-share basis, if applicable, for reasonable costs associated with such services. Police Department Public Works Department 5.14-8 Prior to the final building and zoning inspection, the Prior to the final building and zoning inspection, the property owner shall record a covenant on the property requiring that ongoing during project Public Works Department CAMBRIA HOTELS & SUITES DEV2016-00038, FSP2016-00004 UPDATED AND MODIFIED MITIGATION MONITORING PROGRAM NO. 85C MITIGATION MONITORING PLAN NO. 337 47 Mitigation Measure Number Timing Measure Department Responsible for Monitoring Completion property owner shall record a covenant on the property requiring that ongoing during project implementation implementation, the property owner/developer shall implement and administer a comprehensive Transportation Demand Management (TDM) program for all employees. The form of the covenant shall be approved by the City Attorney’s Office. Objectives of the TDM program shall be: a. Increase ridesharing and use of alternative transportation modes by guests. b. Provide a menu of commute alternatives for employees to reduce project-generated trips. c. Conduct an annual commuter survey to ascertain trip generation, trip origin, and Average Vehicle Ridership. 5.14-9 Prior to the final building and zoning inspection Prior to the final building and zoning inspection, the property owner/developer shall provide to the City of Anaheim Public Works Department for review and approval a menu of TDM program strategies and elements for both existing and future employees’ commute options, and incentives for hotel patrons’ transportation options. These options may include, but are not limited to, the list below. The property owner shall also record a covenant on the property requiring that the approved TDM strategies and elements be implemented ongoing during project operation. The form of the covenant shall be approved by the City Attorney’s Office prior to recordation. a. On-site services. Provide, as feasible and permitted, on-site services such as the food, retail, and other services. b. Ridesharing. Develop a commuter listing of all employee members for the purpose of providing a “matching” of employees with other employees who live in the same geographic areas and who could rideshare. c. Vanpooling. Develop a commuter listing of all employees for the Public Works Department CAMBRIA HOTELS & SUITES DEV2016-00038, FSP2016-00004 UPDATED AND MODIFIED MITIGATION MONITORING PROGRAM NO. 85C MITIGATION MONITORING PLAN NO. 337 48 Mitigation Measure Number Timing Measure Department Responsible for Monitoring Completion purpose of matching numbers of employees who live in geographic proximity to one another and could comprise a vanpool or participate in the existing vanpool programs. d. Transit Pass. Promote Orange County Transportation Authority (including commuter rail) passes through financial assistance and on- site sales to encourage employees to use the various transit and bus services from throughout the region. e. Shuttle Service. Generate a commuter listing of all employees living in proximity to the project, and offer a local shuttle program to encourage employees to travel to work by means other than the automobile. When appropriate, event shuttle service shall also be made available for guests. f. Bicycling. Develop a Bicycling Program to offer a bicycling alternative to employees. Secure bicycle racks, lockers, and showers should be provided as part of this program. Maps of bicycle routes throughout the area should be provided to inform potential bicyclists of these options. g. Guaranteed Ride Home Program. Develop a program to provide employees who rideshare, or use transit or other means of commuting to work, with a prearranged ride home in a taxi, rental car, shuttle, or other vehicle, in the event of emergencies during the work shift. h. Target Reduction of Longest Commute Trip. Promote an incentive program for ridesharing and other alternative transportation modes to put highest priority on reduction of longest employee commute trips. i. Work Shifts. Stagger work shifts. j. Compressed Work Week. Develop a “compressed work week” program, which provides for fewer work days but longer daily shifts as CAMBRIA HOTELS & SUITES DEV2016-00038, FSP2016-00004 UPDATED AND MODIFIED MITIGATION MONITORING PROGRAM NO. 85C MITIGATION MONITORING PLAN NO. 337 49 Mitigation Measure Number Timing Measure Department Responsible for Monitoring Completion an option for employees. k. Telecommuting. Explore the possibility of a “telecommuting” program that would link some employees via electronic means (e.g., computer with modem). l. Parking Management. Develop a parking management program that provides incentives to those who rideshare or use transit means other than single-occupant auto to travel to work. m. Access. Provide preferential access to high occupancy vehicles and shuttles. n. Financial Incentive for Ridesharing and/or Public Transit. Offer employees financial incentives for ridesharing or using public transportation. Currently, federal law provides tax-free status for up to $65 per month per employee contributions to employees who vanpool or use public transit including commuter rail and/or express bus pools. o. Financial Incentive for Bicycling. Offer employees financial incentives for bicycling to work. p. Special “Premium” for the Participation and Promotion of Trip Reduction. Offer ticket/passes to special events, vacations, etc. to employees who recruit other employees for vanpool, carpool, or other trip reduction programs. q. Incentive Programs. Design incentive programs for carpooling and other alternative transportation modes so as to put highest priority on reduction of longest commute trips. 5.14-12 Prior to the issuance of the first building permit Prior to the issuance of the first building permit, the location of any proposed gates across a driveway shall be subject to the review and approval of the City Engineer. Gates shall not be installed across any driveway or private Public Works Department CAMBRIA HOTELS & SUITES DEV2016-00038, FSP2016-00004 UPDATED AND MODIFIED MITIGATION MONITORING PROGRAM NO. 85C MITIGATION MONITORING PLAN NO. 337 50 Mitigation Measure Number Timing Measure Department Responsible for Monitoring Completion street in a manner which may adversely affect vehicular traffic on the adjacent public streets. Installation of any gates shall conform to the current version of Engineering Standard Detail No. 475. 5.14-13 Prior to the issuance of building permits Prior to the issuance of building permits, plans shall show that all driveways shall be constructed with a minimum fifteen (15) foot radius curb returns as required by the City Engineer, unless otherwise approved by the City Engineer. Public Works Department 5.14-14 Prior to the issuance of building permits or final map approval, whichever occurs first Prior to the issuance of building permits or final map approval, whichever occurs first, security in the form of a bond, certificate of deposit, letter of credit, completion guarantee, or cash, in an amount and form satisfactory to the City Engineer shall be posted with the City to guarantee the satisfactory completion of all engineering requirements of the City of Anaheim, including preparation of improvement plans and installation of all improvements, such as curbs and gutters, sidewalks, water facilities, street grading and pavement, sewer and drainage facilities and other appurtenant work, as required by the City Engineer and in accordance with the specifications on file in the office of the City Engineer, as may be modified by the City Engineer. Installation of said improvements shall occur prior to final building and zoning inspections. Public Works Department 5.14-19 Prior to the approval of the final subdivision map or issuance of building permits, whichever occurs first Prior to the approval of the final subdivision map or issuance of building permits, whichever occurs first, the property owner/developer shall pay the identified fair-share responsibility as determined by the City as set forth in MM 5.14-15. The City shall allocate the property owner/developer’s fair- share contribution to traffic mitigation programs that result in improved traffic flow on the impacted mainline and ramp locations, via an agreement mutually acceptable to Caltrans and the City. Public Works Department 5.14-21 Prior to the first final building and zoning Inspection Prior to the first final building and zoning Inspection every property owner and/or lessee shall designate an on-site contact that will be responsible for coordinating with the ATN and implementing all trip mitigation measures. The on-site coordinator shall be the one point of contact representing the Public Works Department CAMBRIA HOTELS & SUITES DEV2016-00038, FSP2016-00004 UPDATED AND MODIFIED MITIGATION MONITORING PROGRAM NO. 85C MITIGATION MONITORING PLAN NO. 337 51 Mitigation Measure Number Timing Measure Department Responsible for Monitoring Completion project with the ATN. The TDM requirements shall be included in the lease or other agreement with all of the project participants. WATER SUPPLY AND INFRASTRUCTURE 5.15-2 Prior to issuance of each building permit Prior to issuance of each building permit, all water supply planning for the project will be closely coordinated with, and be subject to the review and final approval of, the Public Utilities Department, Water Engineering Division and Fire Department. Public Utilities Department Fire Department 5.15-3 Prior to issuance of each building permit Prior to issuance of each building permit, water pressure greater than 80 pounds per square inch (psi) shall be reduced to 80 psi or less by means of pressure reducing valves installed at the property owner/developer’s service. Planning and Building Department 5.15-4 Prior to the issuance of each building permit Prior to the issuance of each building permit, the property owner/developer shall submit a landscape and irrigation plan which shall be prepared and certified by a licensed landscape architect. The irrigation plan shall specify methods for monitoring the irrigation system. The system shall ensure that irrigation rates do not exceed the infiltration of local soils, that the application of fertilizers and pesticides do not exceed appropriate levels of frequencies, and that surface runoff and overwatering is minimized. The landscaping and irrigation plans shall include water-conserving features such as low flow irrigation heads, automatic irrigation scheduling equipment, flow sensing controls, rain sensors, soil moisture sensors, and other water-conserving equipment. The landscaping and irrigation plans shall indicate that separate irrigation lines for recycled water shall be constructed and recycled water will be used when it becomes available. All irrigation systems shall be designed so that they will function properly with recycled water. Planning and Building Department 5.15-5 Prior to approval of the Final Site Plan and building permits Prior to approval of the Final Site Plan and building permits, plans shall specifically show that the water meter and backflow equipment and any other large water system equipment will be installed to the satisfaction of the Public Utilities Department, Water Engineering Division, aboveground and behind the building setback line in a manner fully screened from all public streets Public Utilities Department CAMBRIA HOTELS & SUITES DEV2016-00038, FSP2016-00004 UPDATED AND MODIFIED MITIGATION MONITORING PROGRAM NO. 85C MITIGATION MONITORING PLAN NO. 337 52 Mitigation Measure Number Timing Measure Department Responsible for Monitoring Completion and alleys and in accordance with Ordinance No. 4156. Prior to the final building and zoning inspections, the water meter and backflow equipment and any other large water system equipment shall be installed to the satisfaction of the Public Utilities Department, Water Engineering Division, in accordance with the Final Site Plan and the building permit plans. 5.15-6 Prior to issuance of each building permit, unless records indicate previous payment Prior to issuance of each building permit, unless records indicate previous payment, the appropriate fees for Primary Mains, Secondary Mains and Fire Protection Service shall be paid to the Public Utilities Department, Water Engineering Division in accordance with Rule 15A, and Rule 20 of the Public Utilities Department Water Rates, Rules and Regulations. Public Utilities Department 5.15-7 Prior to final building and zoning inspections Prior to final building and zoning inspections, a separate water meter shall be installed for landscape water on all projects where the landscape area exceeds 2,500 square feet in accordance with Ordinance No. 6160. Planning and Building Department 5.15-9 Ongoing Ongoing, the City shall continue to collaborate with the Metropolitan Water District of Southern California (MWD), its member agencies, and the Orange County Water District (OCWD) to ensure that available water supplies meet anticipated demand. If it is forecasted that water demand exceeds available supplies, staff shall recommend to City Council to trigger application of the Water Conservation Ordinance (Anaheim Municipal Code, §10.18), as prescribed, to require mandatory conservation measures as authorized by Sections 10.18.070 through 10.18.090, as appropriate. Public Utilities Department SEWER 5.16-1 Prior to approval of a final subdivision map or issuance of a grading or building permit, whichever occurs first Prior to approval of a final subdivision map or issuance of a grading or building permit, whichever occurs first, the property owner/developer shall participate in the City’s Master Plan of Sewers and related Infrastructure Improvement (Fee) Program to assist in mitigating existing and future sanitary sewer system deficiencies as follows: The property owner/developer shall submit a report for review and approval Public Works Department CAMBRIA HOTELS & SUITES DEV2016-00038, FSP2016-00004 UPDATED AND MODIFIED MITIGATION MONITORING PROGRAM NO. 85C MITIGATION MONITORING PLAN NO. 337 53 Mitigation Measure Number Timing Measure Department Responsible for Monitoring Completion of the City Engineer to assist in determining the following: a. If the development/redevelopment (1) does not discharge into a sewer system that is currently deficient or will become deficient because of that discharge and/or (2) does not increase flows or change points of discharge, then the property owner’s/developer’s responsibility shall be limited to participation in the Infrastructure Improvement (Fee) Program. b. If the development/redevelopment (1) discharges into a sewer system that is currently deficient or will become deficient because of that discharge and/or (2) increases flows or changes points of discharge, then the property owner/developer shall be required to guarantee mitigation to the satisfaction of the City Engineer and the City Attorney of the impact prior to approval of a final subdivision map or issuance of a grading or building permit whichever occurs first, pursuant to the improvements identified in the South Central Area Sewer Deficiency Study. The property owner/developer shall be required to install the sanitary sewer facilities, as recommended by the South Central Area Sewer Deficiency Study, prior to acceptance for maintenance of public improvements by the City or final building and zoning inspections for the building/structure, whichever comes first. Additionally, the property owner/developer shall participate in the Infrastructure Improvement (Fee) Program, as determined by the City Engineer, which may include fees, credits, reimbursements, or a combination thereof. As part of guaranteeing the mitigation of impacts for the sanitary sewer system, the property owner/developer shall submit a sanitary sewer system improvement phasing plan for the project to the City Engineer for review and approval which shall contain, at a minimum, (1) a layout of the complete system, (2) all facility sizes, including support calculations, (3) construction phasing, CAMBRIA HOTELS & SUITES DEV2016-00038, FSP2016-00004 UPDATED AND MODIFIED MITIGATION MONITORING PROGRAM NO. 85C MITIGATION MONITORING PLAN NO. 337 54 Mitigation Measure Number Timing Measure Department Responsible for Monitoring Completion and (4) construction estimates. The study shall determine the impact of the project sewer flows for total build out of the project and identify local deficiencies for each project component (i.e., each hotel). ELECTRICITY 5.17-1 Prior to issuance of each building permit Prior to issuance of each building permit, the property owner/develop shall consult with the City of Anaheim Public Utilities Department, Business and Community Programs Division, in order to review energy efficient measures to incorporate into the project design. Prior to the final building and zoning inspection, the property owner developer shall implement these energy efficient measures which may include the following: a. High-efficiency air-conditioning systems with EMS (computer) control b. Variable air volume (VAV) distribution c. Outside air (100%) economizer cycle d. Staged compressors or variable speed drives to flow varying thermal loads e. Isolated HVAC zone control by floors/separable activity areas f. Specification of premium-efficiency electric motors (i.e., compressor motors, air-handling units, and fan-coil units) g. Use of occupancy sensors in appropriate spaces h. Use of compact fluorescent lamps i. Use of cold cathode fluorescent lamps j. Use of light emitting diode (LED) or equivalent energy-efficient lighting for outdoor lighting Public Utilities Department CAMBRIA HOTELS & SUITES DEV2016-00038, FSP2016-00004 UPDATED AND MODIFIED MITIGATION MONITORING PROGRAM NO. 85C MITIGATION MONITORING PLAN NO. 337 55 Mitigation Measure Number Timing Measure Department Responsible for Monitoring Completion k. Use of Energy Star® exit lighting or exit signage. l. Use of T-8 lamps and electronic ballasts where applications of standard fluorescent fixtures are identified m. Use of lighting power controllers in association with metal-halide or high-pressure sodium (high intensity discharge) lamps for outdoor lighting and parking lots n. Consideration of thermal energy storage air-conditioning for spaces or facilities that may require air-conditioning during summer, day-peak periods. o. For swimming pools and spas, incorporate solar heating, automatic covers, and efficient pumps and motors, as feasible. p. Consideration for participation in Advantage Services Programs such as: a. New construction design review, in which the City cost-shares engineering for up to $10,000 for design of energy efficient buildings and systems b. New Construction – cash incentives ($300 to $400 per kW reduction in load) for efficiency that exceeds Title 24 requirements c. Green Building Program – offers accelerated plan approval, financial incentives, waived plan check fees and free technical assistance. 5.17-2 Prior to final building and zoning inspection Prior to final building and zoning inspection, the property owner/developer shall install an underground electrical service from the Public Utilities Distribution System. The Underground Service will be installed in accordance with the Electric Rules, Rates, Regulations and Electrical Specifications for Underground Systems. Electrical Service Fees and other Public Utilities Department CAMBRIA HOTELS & SUITES DEV2016-00038, FSP2016-00004 UPDATED AND MODIFIED MITIGATION MONITORING PROGRAM NO. 85C MITIGATION MONITORING PLAN NO. 337 56 Mitigation Measure Number Timing Measure Department Responsible for Monitoring Completion applicable fees will be assessed in accordance with the Electric Rules, Rates, Regulations and Electrical Specifications for Underground Systems. 5.17-3 Prior to issuance of each building permit Prior to issuance of each building permit, the property owner/developer shall submit plans and calculations to the City of Anaheim Planning and Building Department, Building Division, to demonstrate that the energy efficiency of each building will exceed the Title 24 Energy Efficiency Standards for Residential and Nonresidential Buildings current at the time of application by at least 10 percent. Planning and Building Department STORM WATER 5.18-1 Prior to approval of a final subdivision map, or issuance of a grading or building permit, whichever occurs first Prior to approval of a final subdivision map, or issuance of a grading or building permit, whichever occurs first, the property owner/developer shall participate in the City’s Master Plan of Storm Drains and related Infrastructure Improvement (Fee) Program to assist in mitigating existing and future storm drainage system deficiencies as follows: The property owner/developer shall submit a report for review and approval by the City Engineer to assist with determining the following: a. If the specific development/redevelopment does not increase or redirect current or historic storm water quantities/flows, then the property owner/developer’s responsibility shall be limited to participation in the Infrastructure Improvement (Fee) Program to provide storm drainage facilities in 10- and 25-year storm frequencies and to protect properties/structures for a 100-year storm frequency. b. If the specific development/redevelopment increases or redirects the current or historic storm water quantity/flow, then the property owner/developer shall be required to guarantee mitigation to the satisfaction of the City Engineer and City Attorney’s office of the impact prior to approval of a final subdivision map or issuance of a grading or building permit, whichever occurs first, pursuant to the Public Works Department CAMBRIA HOTELS & SUITES DEV2016-00038, FSP2016-00004 UPDATED AND MODIFIED MITIGATION MONITORING PROGRAM NO. 85C MITIGATION MONITORING PLAN NO. 337 57 Mitigation Measure Number Timing Measure Department Responsible for Monitoring Completion improvements identified in the Master Plan of Drainage for the South Central Area. The property owner/developer shall be required to install the storm drainage facilities as recommended by the Master Plan of Drainage for the South Central Area to provide storm drainage facilities for 10- and 25-year storm frequencies and to protect properties/structures for a 100-year storm frequency prior to acceptance for maintenance of public improvements by the City or final building and zoning inspection for the building/structure, whichever occurs first. Additionally, the property owner/developer shall participate in the Infrastructure Improvement (Fee) Program as determined by the City Engineer which could include fees, credits, reimbursements, or a combination thereof. As part of guaranteeing the mitigation of impacts on the storm drainage system, a storm drainage system improvement phasing plan for the project shall be submitted by the property owner/developer to the City Engineer for review and approval and shall contain, at a minimum, (1) a layout of the complete system; (2) all facility sizes, including support calculations; (3) construction phasing; and, (4) construction estimates. 5.18-3 Prior to the issuance of building permits Prior to the issuance of building permits, the City shall require that building plans indicate that new developments will minimize stormwater and urban runoff into drainage facilities by incorporating design features such as detention basins, on-site water features, and other strategies. Planning and Building Department OTHER PUBLIC UTILITIES CAMBRIA HOTELS & SUITES DEV2016-00038, FSP2016-00004 UPDATED AND MODIFIED MITIGATION MONITORING PROGRAM NO. 85C MITIGATION MONITORING PLAN NO. 337 58 Mitigation Measure Number Timing Measure Department Responsible for Monitoring Completion 5.19-1 Prior to issuance of each building permit; to be implemented prior to final building and zoning Inspection Prior to issuance of each building permit; to be implemented prior to final building and zoning Inspection, the property owner/developer shall submit project plans to the Public Works Department for review and approval to ensure that the plans comply with AB 939, the Solid Waste Reduction Act of 1989, as administered by the City of Anaheim and the County of Orange and City of Anaheim Integrated Waste Management Plans. Prior to final building and zoning inspection, implementation of said plan shall commence and shall remain in full effect. Waste management mitigation measures that shall be Public Works Department CAMBRIA HOTELS & SUITES DEV2016-00038, FSP2016-00004 UPDATED AND MODIFIED MITIGATION MONITORING PROGRAM NO. 85C MITIGATION MONITORING PLAN NO. 337 59 Mitigation Measure Number Timing Measure Department Responsible for Monitoring Completion taken to reduce solid waste generation include, but are not limited to: a. Detailing the location and design of on-site recycling facilities. b. Providing on-site recycling receptacles to encourage recycling. c. Complying with all Federal, State and City regulation for hazardous material disposal. d. Participating in the City of Anaheim’s “Recycle Anaheim” program or other substitute program as may be developed by the City. In order to meet the requirements of the Solid Waste Reduction Act of 1989 (AB 939), the property owner/developer shall implement numerous solid waste reduction programs, as required by the Public Works Department, including, but not limited to: a. Facilitating recycling by providing chutes or convenient locations for sorting and recycling bins. b. Facilitating cardboard recycling (especially in retail areas) by providing adequate space and centralized locations for collection and storing. c. Facilitating glass recycling (especially from restaurants) by providing adequate space for sorting and storing. d. Providing trash compactors for non-recyclable materials whenever feasible to reduce the total volume of solid waste and the number of trips required for collection. e. Prohibiting curbside pick-up. 5.19-2 Ongoing during project operation Ongoing during project operation, the following practices shall be implemented, as feasible, by the property owner/developer: Public Works Department CAMBRIA HOTELS & SUITES DEV2016-00038, FSP2016-00004 UPDATED AND MODIFIED MITIGATION MONITORING PROGRAM NO. 85C MITIGATION MONITORING PLAN NO. 337 60 Mitigation Measure Number Timing Measure Department Responsible for Monitoring Completion a. Usage of recycled paper products for stationary, letterhead, and packaging. b. Recovery of materials such as aluminum and cardboard. c. Collection of office paper for recycling. d. Collection of polystyrene (foam) cups for recycling. e. Collection of glass, plastics, kitchen grease, laser printer toner cartridges, oil, batteries, and scrap metal for recycling or recovery. 5.19-3 Prior to issuance of building permits Prior to issuance of building permits, plans shall show that trash storage areas shall be provided and maintained in a location acceptable to the City of Anaheim Department of Public Works, Operations Division. On an ongoing basis, trash storage areas shall be provided and maintained in accordance with approved plans on file with said Department. Public Works Department 5.19-4 Prior to issuance of each building permit, Prior to issuance of each building permit, the Property Owner/Developer shall demonstrate that the plans include provisions for the installation of trash and recycle receptacles near all benches and near high traffic areas such as plazas, transit stops and retail and dining establishments. Public Works Department 5.19-5 Prior to issuance of each grading and building permit Prior to issuance of each grading and building permit, the Property Owner/Developer shall submit to the Planning Director or Planning Services Manager for approval a Construction Waste Management Plan that, at a minimum, specifies that at least 75 percent of non-hazardous construction and demolition debris shall be recycled or salvaged and identifies the materials to be diverted from disposal and whether the materials will be sorted on site or co-mingled. Planning and Building Department 200 S. Anaheim Blvd. Suite #162 Anaheim, CA 92805 Tel: (714) 765-5139 Fax: (714) 765-5280 www.anaheim.net City of Anaheim PLANNING DEPARTMENT There is no new correspondence regarding this item. 200 S. Anaheim Blvd. Suite #162 Anaheim, CA 92805 Tel: (714) 765-5139 Fax: (714) 765-5280 www.anaheim.net ITEM NO. 2 PLANNING COMMISSION REPORT City of Anaheim PLANNING AND BUILDING DEPARTMENT DATE: NOVEMBER 28, 2016 SUBJECT: CONDITIONAL USE PERMIT NO. 2010-05486G LOCATION: 2232 South Harbor Boulevard (M3Live Anaheim Event Center) APPLICANT/PROPERTY OWNER: The applicant is Musa Madain and the property owner is P.A. Poon and Son, Inc. REQUEST: The applicant requests to amend the conditional use permit approved for the M3Live Event Center to extend the permitted hours of operation and remove existing tables from the theater portion of the venue. RECOMMENDATION: Staff recommends that the Planning Commission approve the attached resolution, determining that this request is categorically exempt from further environmental review under the California Environmental Quality Act (Class 1, Existing Facilities), and approve, in part, Conditional Use Permit No. 2010-05486G. BACKGROUND: In July 2010, a conditional use permit (CUP) was approved to permit a 43,500 square foot dinner theater venue, known as Battle of the Dance, at 2232 South Harbor Boulevard, in a building that formerly contained a Toys R Us store. This property is located within The Anaheim Resort, a special area of the City that surrounds and includes the Disney theme parks and the Anaheim Convention Center. The subject property is designated by the General Plan for Commercial Recreation land use and is subject to the Anaheim Resort Specific Plan (ARSP). The ARSP is intended to encourage the development of uses related to entertaining, lodging and supplying services to tourists and visitors. Adjacent properties along Harbor Boulevard to the north and south are also within The Anaheim Resort and developed with commercial uses. Properties directly across Harbor Boulevard are within the City of Garden Grove and developed with hotels. Properties to the east and southeast of the subject property are within the City of Anaheim, outside of The Anaheim Resort, and are developed with residential condominiums. The Battle of the Dance dinner theater opened for business in February 2011. In May 2012, its CUP was amended to allow various activities accessory to the dinner theatre operations, including private parties, meetings and banquets, religious assembly, and, sporting and convention events. Battle of the Dance subsequently closed in late 2012 CONDITIONAL USE PERMIT NO. 2010-05486G November 28, 2016 Page 2 of 6 and the building remained vacant until occupied by the current tenant, M3Live Anaheim Event Center. M3Live made substantial renovations to the building and opened for business in September 2014. The initial business description for M3Live included dinner theater shows on Friday and Saturday nights and a restaurant that would operate from Sunday through Thursday. Prior to its opening, the Commission reviewed revised floor plans for M3Live to convert the front portion of the building to a restaurant dining area. This area had been used as a large lobby area, including a small stage, when operated as Battle of the Dance. The approved modification did not include changes to the conditions of approval, and the new (current) operator agreed to abide by all of the pre-existing conditions of the CUP, including a six-month compliance review. On May 18, 2015, the Commission considered a six-month compliance review for M3Live. The compliance review included a request by the applicant to amend the CUP by removing the requirement to provide dinner in conjunction with theater shows, expand the hours of operation and revise the venue’s floor plan. The Commission approved the request, in part, permitting live shows in the theater without dinner, with the exception of musical concerts; extending the hours of operation for banquets until midnight on Friday and Saturday nights; and, revising the floor plan for the main dining room. The approved changes to the dining room included relocation of the bar from the middle of the room to a side wall, but these physical changes have not been implemented. On December 14, 2015, the Commission considered a second six-month compliance review for M3Live. The compliance review included a request by the applicant to amend the CUP to allow concerts in the theater, allow the restaurant to operate concurrently with events in the theater, extend the permitted hours of operation for the restaurant until 2 a.m., daily, and amend a condition pertaining to parking lot lighting. The Commission approved the request, in part, denying the portion pertaining to later hours of operation. On June 27, 2016 the Commission considered a third six-month compliance review for M3Live. The compliance review included a request by the applicant to amend the CUP to allow public parking when the venue is not in use and amend the conditions of approval pertaining to operations, including the permitted hours of operation. The Commission approved the request, in part, denying the portion pertaining to later hours of operation with the exception of allowing operation until 2 a.m. on New Year’s Eve. The action also included removing the requirement for six month reviews. The applicant appealed the decision to the City Council, then subsequently withdrew the appeal after meeting with staff to discuss a modified request that would allow extended weekend hours for the banquet facility. PROPOSAL: The applicant requests the following amendments to the conditional use permit: 1. Extend the permitted hours of operation for the banquet hall and restaurant from midnight to 12:30 a.m. for events on Friday and Saturday nights; 2. Extend the allowed time to clear the property of guests from 30 minutes to 45 minutes; and 3. Delete condition no. 4 to have the ability to remove the tables in the theater. CONDITIONAL USE PERMIT NO. 2010-05486G November 28, 2016 Page 3 of 6 FINDINGS AND ANALYSIS: Before the Planning Commission may amend a conditional use permit, it must make a finding of fact that the evidence presented shows that all of the following conditions exist: 1) That the proposed use is properly one for which a conditional use permit is authorized by this code; 2) That the proposed use will not adversely affect the adjoining land uses, or the growth and development of the area in which it is proposed to be located; 3) That the size and shape of the site proposed for the use is adequate to allow the full development of the proposed use, in a manner not detrimental to either the particular area or health and safety; 4) That the traffic generated by the proposed use will not impose an undue burden upon the streets and highways designed and improved to carry the traffic in the area; and 5) That the granting of the conditional use permit under the conditions imposed, if any, will not be detrimental to the health and safety of the citizens of the City of Anaheim. Hours of Operation: The table below includes the current permitted hours of operation on the left and the proposed hours on the right, with the requested changes identified in bold underline. Condition No. 2 – Hours of Operation Approved Proposed Hours of operation shall be limited to the following: Banquets and Restaurant:  Sunday – Thursday: 9:00 a.m. to 10:00 p.m.  Friday/Saturday: 9:00 a.m. to midnight Theater:  Sunday – Thursday: 9:00 a.m. to 10:00 p.m.  Friday/Saturday: 9:00 a.m. to 11:30 p.m. New Year’s Eve:  9:00 a.m. to 2:00 a.m. (the following day) Guests must be cleared from the property within 30 minutes of the time limits stated above. Security personnel shall be responsible for maintaining orderly conduct and prompt exiting from the property. The disassembly and/or loading of equipment following events shall cease no later than one hour beyond the time limits stated above. Hours of operation shall be limited to the following: Banquets and Restaurant:  Sunday – Thursday: 9:00 a.m. to 10:00 p.m.  Friday/Saturday: 9:00 a.m. to 12:30 a.m. Theater:  Sunday – Thursday: 9:00 a.m. to 10:00 p.m.  Friday/Saturday: 9:00 a.m. to 11:30 p.m. New Year’s Eve:  9:00 a.m. to 2:00 a.m. (the following day) Guests must be cleared from the property within 45 minutes of the time limits stated above. Security personnel shall be responsible for maintaining orderly conduct and prompt exiting from the property. The disassembly and/or loading of equipment following events shall cease no later than one hour beyond the time limits stated above. CONDITIONAL USE PERMIT NO. 2010-05486G November 28, 2016 Page 4 of 6 Staff is supportive of both requests, with the addition of the conditions of approval described below. The request for an additional 15 minutes to clear the property of guests would allow the applicant to do so in a more orderly fashion. The request for an additional 30 minutes of operating time would apply to the restaurant and private banquet events only. It would not apply to the theater which is currently allowed to operate until 10:00 p.m. on weekdays and 11:30 p.m. on weekends. In order to accommodate this request, staff recommends the following conditions of approval to be added to the permit: Recommended Condition No. 1: “This permit shall be reviewed by the Planning Commission as a Reports and Recommendations item in one year to review and determine whether the extended hours of operation are creating negative impacts upon the surrounding community. The review will include a mailed notice to surrounding property owners.” Condition No. 2 pertains to the hours of operation; the existing hours and hours proposed by the applicant are detailed in the table above and would be reflected in the revised condition. Recommended Condition No. 3: “The primary purpose of this business, as it relates to the banquet facility, is to serve as a private event space to host events such as weddings, quinceaneras, and corporate events. The venue shall not be operated as a bar, dance venue, or nightclub. As such, the following conditions of approval shall apply to all events in the banquet hall that end between 11:30 p.m. to 12:30 a.m.: a. Events must operate in compliance with the definition of a “Banquet Facility” as defined in the Anaheim Municipal Code, including service of a full meal. b. The parking area directly east of the building must be cordoned off such that only employees of the facility shall be permitted to park behind the building, with the exception of “last-load” valet parking along the east property line, as needed. c. Parking attendants shall direct patrons to a specific parking area, filling the front parking spaces first, and filling spaces toward the rear of the lot last.” Recommended Condition No. 4: “So long as M3Live Bar and Grill is the owner and operator of the business located at the subject property (herein referred to as the "Original Owner/Operator"), the permitted uses described in Condition No. 3 that are held on Fridays and Saturdays shall be allowed only between the hours of 9 a.m. and 12:30 a.m., and no later. The rights contained in Condition No. 3 shall be personal to the Original Owner/Operator and may be exercised only by the Original Owner/Operator and not by any assignee, sublessee or other transferee of the Original Owner/Operator's interest in the subject property or any portion thereof. In the event the Original Owner/Operator is no longer the owner and operator of the business located at the subject property, the permitted uses described in Condition No. 3 that are held on Fridays and Saturdays shall be allowed only between the hours of 9 a.m. and 12:00 a.m. (midnight), and no later.” Recommended Condition No. 5: “Notwithstanding the preceding condition (i.e., Condition No. 3, permitting the Original Owner/Operator to use the premises for those permitted uses described in Condition No. 3 on Fridays and Saturdays between the hours of 9 a.m. and 12:30 a.m.), if the Planning Director determines, following consultation with the Police Chief CONDITIONAL USE PERMIT NO. 2010-05486G November 28, 2016 Page 5 of 6 (or his/her designee) and/or the Community Preservation Manager (or his/her designee), that use of the premises on Fridays and Saturdays beyond 12:00 a.m. (midnight) has resulted in an increase in calls for service to the subject property or has disturbed the peace and quiet of the residential neighborhood adjacent to the subject property, the Planning Director, in his/her discretion, shall have the authority to require the Original Owner/Operator to limit the use of the premises on Fridays and Saturdays to not later than 12:00 a.m. (midnight) following the giving of written notice to the Original Owner/Operator. The Original Owner/Operator shall promptly comply with such notice. This decision may be appealed to the Planning Commission as provided in Chapter 18.60 (Procedures).” Planning and Police staff believe that with the proposed conditions of approval, the business would operate in a manner that is compatible with the surrounding land uses. The requirement for a one year review would allow the Commission to confirm whether the business owner has been operating in compliance with the permit and evaluate the effectiveness of the operating conditions. Staff has added specific criteria to recommended Condition No. 3 that would apply to any event that is planned to end later than 11:30. First, all events must comply with the following Anaheim Municipal Code definition of a banquet facility: “This use class consists of a facility rented out for private events, which involve the service of a meal and at which seating is provided at tables. As used herein, “private event” means a gathering of persons who has been individually invited to the event and from which persons not so invited are excluded. Live entertainment and dancing is permitted in a banquet hall; however, such live entertainment or dancing shall not be the primary use of a banquet hall. Alcoholic beverages may be sold or consumed within a banquet hall during a private event subject to state law requirements and if allowed by a conditional use permit.” Second, this condition also requires that the parking area behind the building be cordoned off and that guests shall be directed to park on the north side of the property. Recommended Condition No. 4 limits the 30 minutes of additional operating time to the current operator. If M3 Live is sold to another entity, the new entity would be subject to the original timeframes, ending at midnight on Friday and Saturday nights. Finally, recommended Condition No. 5 gives the Planning Director the authority to revoke the additional 30 minutes if staff determines that the later time has resulted in negative impacts to the neighboring residential community. Tables in the Theater: Existing Condition No. 5 reads as follows: “The tables and table covers shall be maintained in the theater during events to serve as sound absorption.” The applicant requests that this condition be deleted since the building was soundproofed last year and some organizations inquiring about use of the theater have requested that they be removed. As described in the letter of request, the tables and covers would remain in place for most events; the CONDITIONAL USE PERMIT NO. 2010-05486G November 28, 2016 Page 6 of 6 removal of the tables is primarily requested to accommodate religious events. Staff has included a condition of approval that a sound test shall be conducted without the tables and covers prior to the removal for an event. Staff proposes that the existing condition be deleted and replaced with recommended Condition No. 8: “Prior to removing tables and chairs from the theater for events, sound tests shall be conducted by City staff to determine if the existing permanent sound absorption solutions are sufficient. The sound test will include playing recorded music at 85 decibels in the theater to discern whether the music is audible at the property line. If the music is audible, the tables and covers must remain or the business owner must make additional improvements until the noise is deemed by staff to be adequately mitigated. The property owner shall pay for all City staff costs associated with the monitoring.” Correspondence: Staff has received the attached letter, dated November 20, 2016 and email, dated November 21, 2016, opposing the extended hours of operation. Environmental Analysis: Staff recommends the Planning Commission find that the effects of the proposed project are typical of those generated within that class of projects (i.e., Class 1 – Existing Facilities) which consist of the repair, maintenance, and/or minor alteration of existing public or private structures or facilities, involving negligible or no expansion of use beyond that existing at the time of this determination. Pursuant to Section 15301 of Title 14 of the California Code of Regulations, the proposed project will not cause a significant effect on the environment and is, therefore, categorically exempt from the provisions of CEQA. CONCLUSION: Staff supports the applicant’s request for extended operating hours for banquets and the restaurant, an additional 15 minutes to clear the property of guests, and the removal of tables in the theater, subject to the recommended conditions of approval. Prepared by, Submitted by, Elaine Thienprasiddhi Jonathan E. Borrego Senior Planner Planning Services Manager Attachments: 1. Draft Resolution 2. Current Resolution 3. Applicant’s Letter of Request 4. Correspondence in Opposition to the Request 5. Previously-Approved Site and Floor Plans SP 92-2 (MU)DA1THEATER SP 92-2DA1PARKINGLOT RM-2SMOKETREETOWNHOMES123 DU SP 92-2DA1RESTAURANT SP 92-2DA1COMFORT INNMAINGATE RS-2S.F.R. SP 92-2DA1RENT FOR LESS RM-2CONDOMINIUMS95 DU RM-3CONDOMINIUMS106 DU SP 92-2DA1AUTOREPAIR/SERVICE SP 92-2DA1MEDICAL OFFICE RM-3CONDOMINIUMS64 DU SP 92-2DA1QUALITY INN MAINGATESP 92-2DA1JACK IN THE BOXRESTAURANT SP 92-2DA1BANK RM-2CONDOMINIUMS95 DU SP 92-2DA1RETAIL SP 92-2DA1RETAIL RM-2CONDOMINIUMS95 DU RM-4HARBOR CLIFFAPARTMENTS130 UNITS SP 92-2DA1HACIENDA INN& SUITES SP 92-2DA1RETAIL C-G4PLEX RS-2S.F.R. S H A R B O R B L V D W WILKEN WAY S W IL L O W B R O O K L N S M A D R I D S T S M A L L U L D R S S MIRA CT S CUTTY WAY W S U M M E R F I E L D C I R W. KATELLA AVE S . W E S T S TS. N I N T H S T W.ORANGEWOOD AVE S . H A S T E R S T E. KATELLA AVE E. CHAPMAN AVE E. GENE AUTRY WAY E. ORANGEWOOD AVE 2232 South Harbor Boulevard DEV No. 2009-00083G Subject Property APN: 233-051-08 °0 50 100 Feet Aerial Photo:June 2015 S H A R B O R B L V D W WILKEN WAY S W IL L O W B R O O K L N S M A D R I D S T S M A L L U L D R S S MIRA CT S CUTTY WAY W S U M M E R F I E L D C I R W. KATELLA AVE S . W E S T S TS. N I N T H S T W.ORANGEWOOD AVE S . H A S T E R S T E. KATELLA AVE E. CHAPMAN AVE E. GENE AUTRY WAY E. ORANGEWOOD AVE 2232 South Harbor Boulevard DEV No. 2009-00083G Subject Property APN: 233-051-08 °0 50 100 Feet Aerial Photo:June 2015 [DRAFT] ATTACHMENT NO. 1 - 1 - PC2016-*** RESOLUTION NO. PC2016-*** A RESOLUTION OF THE PLANNING COMMISSION OF THE CITY OF ANAHEIM APPROVING AN AMENDMENT TO CONDITIONAL USE PERMIT NO. 2010-05486, AMENDING CONDITIONS OF APPROVAL OF RESOLUTION NO. PC 2016-056 AND MAKING CERTAIN FINDINGS IN CONNECTION THEREWITH (DEV2009-00083G) (2232 SOUTH HARBOR BOULEVARD) WHEREAS, on July 19, 2010, and subject to certain conditions of approval, the Planning Commission of the City of Anaheim (hereinafter referred to as ("Planning Commission"), by its Resolution No. PC2010-057, did approve Conditional Use Permit 2010-05486 (the "Original CUP") to permit the conversion of two adjoined vacant commercial buildings located on a legal, non-conforming 4.8-acre site into the “Battle of the Dance” dinner theater, which included enhanced landscaping and wall murals, located at 2232 South Harbor Boulevard, City of Anaheim, County of Orange, State of California (the “Property”), as generally depicted on the map attached hereto as Exhibit A and incorporated herein by this reference; and WHEREAS, on May 7, 2012, and subject to certain conditions of approval, the Planning Commission, by its Resolution No. PC2012-033, approved an amendment to the Original CUP (designated as “Conditional Use Permit No. 2010-05486B”) to permit additional entertainment and community assembly uses (including private parties, meetings and banquets, religious services, and sporting and convention events) in conjunction with a previously-approved dinner theater, with or without the sale of alcoholic beverages for on-premises consumption, but denied the request to allow public dances (dance venue), launch parties and music concerts (herein referred to as the "2012 Amendment"); and WHEREAS, on April 7, 2014, and subject to certain conditions of approval, the Planning Commission, by motion, approved a minor amendment to the Original CUP (designated as “Conditional Use Permit No. 2010-05486C”) to revise the floor plan for a previously-approved dinner theater, restaurant, and banquet facility to accommodate a full-service restaurant and dinner theater (herein referred to as the "2014 Amendment"); and WHEREAS, on May 18, 2015, and subject to certain conditions of approval, the Planning Commission, by its Resolution No. PC2015-037, approved an amendment to the Original CUP (designated as “Conditional Use Permit No. 2010-05486D”), in part, to change the use from a dinner theater to a live performance theater, to extend the operating hours an additional one half hour for the banquet facility and restaurant, and to modify previously-approved floor plans, while denying that portion of the request to extend the hours of operation for the restaurant and the banquet facilities (herein referred to as the "May 2015 Amendment"); and WHEREAS, on December 14, 2015, and subject to certain conditions of approval, the Planning Commission, by its Resolution No. PC2015-097, approved an amendment to the Original CUP (designated as “Conditional Use Permit No. 2010-05486E”), in part, to allow concerts in the theater, to allow the restaurant to operate concurrently with events in the theater, and to amend a condition pertaining to lighting, while denying that portion of the request - 2 - PC2016-*** pertaining to extended hours of operation (herein referred to as the "December 2015 Amendment"); and WHEREAS, on June 27, 2016, and subject to certain conditions of approval, the Planning Commission, by its Resolution No. PC 2016-056, approved an amendment to the Original CUP (designated as “Conditional Use Permit No. 2010-05486F”), in part, to remove the requirement for a six-month review, allow public parking when the venue is not in use, operation until 2.a.m. on New Year’s Eve, concurrent use of the theater and main dining room for banquets, modifying a condition pertaining to patrons parking on-site, and modifying a condition to clarify that a public hearing is required to revoke the permit, while denying that portion of the request pertaining to later hours for the banquets, more time to clear the property of guests, removal of the condition pertaining to tables and table covers for sound absorption, and earlier operating hours on Sundays for religious events (herein referred to as the "June 2016 Amendment"); and WHEREAS, the Original CUP, the 2012 Amendment, the 2014 Amendment, the May 2015 Amendment, December 2015 Amendment, and the June 2016 Amendment shall be referred to collectively herein as the "CUP". The conditions of approval which were the subject of the Original CUP, as amended and modified by the 2012 Amendment, the 2014 Amendment, the May 2015 Amendment, December 2015 Amendment, and the June 2016 Amendment shall be referred to herein collectively as the "Previous Conditions of Approval"; and WHEREAS, this Property is currently developed with a 43,500 square foot building, located within the boundaries of the Anaheim Resort Specific Plan and within the Commercial Recreation (C-R) District (Development Area 1) of the Anaheim Resort Specific Plan Zone. The Property is designated for Commercial Recreation land uses in the Anaheim General Plan; and WHEREAS, the Planning Commission did receive a verified petition to further amend the CUP (designated as "Conditional Use Permit No. 2010-05486G") to (1) extend the hours of operation for the banquet hall and restaurant from midnight to 12:30 a.m. for events on Friday and Saturday nights; (2) Extend the allowed time to clear the property of guests from 30 minutes to 45 minutes ; and (3) delete condition no. 4 to have the ability to remove the tables in the theater, as more particularly described in the staff report presented at this hearing (herein referred to as the "Proposed Project"); and WHEREAS, the Planning Commission did hold a public hearing at the Civic Center in the City of Anaheim on November 18, 2016 at 5:00 p.m., notice of said public hearing having been duly given as required by law and in accordance with the provisions of Chapter 18.60 (Procedures) of the Anaheim Municipal Code (the "Code"), to hear and consider evidence for and against said proposed Conditional Use Permit No. 2010-05486G, and to investigate and make findings and recommendations in connection therewith; and WHEREAS, pursuant to and in accordance with the provisions of the California Environmental Quality Act (Public Resources Code Section 21000 et seq.; herein referred to as “CEQA”), the State of California Guidelines for Implementation of the California Environmental Quality Act (Title 14 of the California Code of Regulations; herein referred to as the "CEQA Guidelines"), and the City's Local CEQA Procedure Manual, the City is the "lead agency" for the preparation and consideration of environmental documents for the Proposed Project; and - 3 - PC2016-*** WHEREAS, the Planning Commission finds and determines that the effects of the Proposed Project are typical of those generated within that class of projects (i.e., Class 1 – Existing Facilities) which consist of the operation, repair, maintenance, permitting, leasing, licensing, or minor alteration of existing public or private structures, facilities, mechanical equipment, or topographical features, involving negligible or no expansion of use beyond that existing at the time of this determination, and that, therefore, pursuant to Section 15301 of the CEQA Guidelines, the Proposed Project will not cause a significant effect on the environment and is, therefore, categorically exempt from the provisions of CEQA; and WHEREAS, the Planning Commission, after due inspection, investigation and study made by itself and in its behalf, and after due consideration of all evidence and reports offered at said hearing pertaining to the request for an amendment to the CUP, does find and determine the following facts: 1. An Entertainment Venue, Community and Religious Assembly, and Automotive- Public Parking are allowable primary uses and structures, subject to a conditional use permit, at the Property under Section 18.116.070 (Uses – Commercial Recreation (C-R) District (Development Area 1) of the Code. 2. The request for later hours on Friday and Saturday nights, more time to clear the property of guests, and removal of the tables in the theater will not adversely affect the surrounding land uses and the growth and development of the area, with the implementation of the conditions of approval recommended by staff. 3. The size and shape of the site is adequate to allow the full operation of the balance of the uses proposed under Conditional Use Permit No. 2010-05486G in a manner not detrimental to the particular area or to the health, safety and general welfare of the public because no expansion to the building is proposed and all activities would be inside the building. 4. The traffic generated at the site would not impose an undue burden upon the streets and highways designed and improved to carry the traffic in the area because the number of vehicles entering and exiting the site is consistent with traffic impacts associated with the originally-permitted dinner theater. 5. The granting, in part, of the amendment to the CUP, as more particularly described in the staff report presented at this hearing, under the conditions imposed, will not be detrimental to the health and safety of the citizens of the City of Anaheim and will provide a land use that is compatible with the surrounding area. WHEREAS, the Planning Commission determines that the evidence in the record constitutes substantial evidence to support the actions taken and the findings made in this Resolution, that the facts stated in this Resolution are supported by substantial evidence in the record, including testimony received at the public hearing, the staff presentations, the staff report and all materials in the project files. There is no substantial evidence, nor are there other facts, that detract from the findings made in this Resolution. The Planning Commission expressly declares that it considered all evidence presented and reached these findings after due consideration of all evidence presented to it. - 4 - PC2016-*** NOW THEREFORE BE IT RESOLVED that the Planning Commission, for the reasons hereinabove stated, does hereby approve Conditional Use Permit No. 2010-05486G to (1) extend the hours of operation for the banquet hall and restaurant from midnight to 12:30 a.m. for events on Friday and Saturday nights; (2) Extend the allowed time to clear the property of guests from 30 minutes to 45 minutes ; and (3) delete condition no. 4 to have the ability to remove the tables in the theater, as more particularly described in the staff report presented at this hearing. BE IT FURTHER RESOLVED that the Planning Commission does hereby approve Conditional Use Permit No. 2010-05486G contingent upon and subject to the conditions of approval set forth in Exhibit B attached hereto and incorporated herein by this reference (the "Revised Conditions of Approval"). BE IT FURTHER RESOLVED that, effective upon the effective date of this Resolution, the Revised Conditions of Approval hereby amend the Previous Conditions of Approval and hereby replace the Previous Conditions of Approval in their entirety. All references to the conditions of approval for the CUP shall be to the Revised Conditions of Approval attached to this Resolution as Exhibit B, which shall control and govern the CUP, as amended by Conditional Use Permit No. 2010-05486G. BE IT FURTHER RESOLVED that the Revised Conditions of Approval, as they relate to the uses permitted under the CUP, as amended by Conditional Use Permit No. 2010-05486G, are hereby found to be a necessary prerequisite to the proposed use of the Property in order to preserve the health, safety and general welfare of the citizens of the City of Anaheim. Extensions for further time to complete conditions of approval may be granted in accordance with Section 18.60.170 of the Code. Timing for compliance with those conditions of approval that relate to the uses permitted under Conditional Use Permit No. 2010-05486G may be amended by the Planning Director upon a showing of good cause provided (i) equivalent timing is established that satisfies the original intent and purpose of the condition(s), (ii) the modification complies with the Code, and (iii) the applicant has demonstrated significant progress toward establishment of the use or approved development. BE IT FURTHER RESOLVED, that any amendment, modification or revocation of this permit may be processed in accordance with Chapters 18.60.190 (Amendment to Permit Approval) and 18.60.200 (City-Initiated Revocation or Modification of Permits) of the Code. BE IT FURTHER RESOLVED that the Planning Commission does hereby find and determine that adoption of this Resolution is expressly predicated upon applicant's compliance with each and all of the conditions hereinabove set forth. Should any such condition, or any part thereof, be declared invalid or unenforceable by the final judgment of any court of competent jurisdiction, then this Resolution, and any approvals herein contained, shall be deemed null and void. BE IT FURTHER RESOLVED that approval of this application constitutes approval of the proposed request only to the extent that it complies with the Code and any other applicable City, State and Federal regulations. Approval does not include any action or findings as to compliance or approval of the request regarding any other applicable ordinance, regulation or requirement. - 5 - PC2016-*** THE FOREGOING RESOLUTION was adopted at the Planning Commission meeting of November 28, 2016. Said resolution is subject to the appeal provisions set forth in Chapter 18.60 (Procedures) of the Anaheim Municipal Code pertaining to appeal procedures and may be replaced by a City Council Resolution in the event of an appeal. CHAIRPERSON, PLANNING COMMISSION OF THE CITY OF ANAHEIM ATTEST: SECRETARY, PLANNING COMMISSION OF THE CITY OF ANAHEIM STATE OF CALIFORNIA ) COUNTY OF ORANGE ) ss. CITY OF ANAHEIM ) I, Eleanor Morris, Secretary of the Planning Commission of the City of Anaheim, do hereby certify that the foregoing resolution was passed and adopted at a meeting of the Planning Commission of the City of Anaheim held on November 28, 2016, by the following vote of the members thereof: AYES: COMMISSIONERS: NOES: COMMISSIONERS: ABSENT: COMMISSIONERS: IN WITNESS WHEREOF, I have hereunto set my hand this 28th day of November, 2016. SECRETARY, PLANNING COMMISSION OF THE CITY OF ANAHEIM - 6 - PC2016-*** - 7 - PC2016-*** EXHIBIT “B” AMENDMENT TO CONDITIONAL USE PERMIT NO. 2010-05486 (CUP2010-05486G) (DEV2009-00083G) NO. CONDITIONS OF APPROVAL RESPONSIBLE DEPARTMENT OPERATIONAL CONDITIONS 1 This permit shall be reviewed by the Planning Commission as a Reports and Recommendations item in one year to review and determine whether the extended hours of operation are creating negative impacts upon the surrounding community. The review will include a mailed notice to surrounding property owners. Planning and Building Department 2 Hours of operation shall be limited to the following: Banquets and Restaurant:  Sunday – Thursday: 9:00 a.m. to 10:00 p.m.  Friday/Saturday: 9:00 a.m. to 12:30 a.m. Theater:  Sunday – Thursday: 9:00 a.m. to 10:00 p.m.  Friday/Saturday: 9:00 a.m. to 11:30 p.m. New Year’s Eve:  9:00 a.m. to 2:00 a.m. (the following day) Guests must be cleared from the property within 45 minutes of the time limits stated above. Security personnel shall be responsible for maintaining orderly conduct and prompt exiting from the property. The disassembly and/or loading of equipment following events shall cease no later than one hour beyond the time limits stated above. Planning and Building Department Police Department 3 The primary purpose of this business, as it relates to the banquet facility, is to serve as a private event space to host events such as weddings, quinceaneras, and corporate events. The venue shall not be operated as a bar, dance venue, or nightclub. As such, the following conditions of approval shall apply to all events in the banquet hall that end between 11:30 p.m. to 12:30 a.m.: a. Events must operate in compliance with the definition of a “Banquet Facility” as defined in the Anaheim Municipal Code, including service of a full meal. b. The parking area directly east of the building must be cordoned off such that only employees of the facility shall be permitted to park behind the building, with the exception of “last-load” valet parking along the east property line, as needed. Planning and Building Department - 8 - PC2016-*** NO. CONDITIONS OF APPROVAL RESPONSIBLE DEPARTMENT c. Parking attendants shall direct patrons to a specific parking area, filling the front parking spaces first, and filling spaces toward the rear of the lot last. 4 So long as M3Live Bar and Grill is the owner and operator of the business located at the subject property (herein referred to as the "Original Owner/Operator"), the permitted uses described in Condition No. 3 that are held on Fridays and Saturdays shall be allowed only between the hours of 9 a.m. and 12:30 a.m., and no later. The rights contained in this Condition No. 3 shall be personal to the Original Owner/Operator and may be exercised only by the Original Owner/Operator and not by any assignee, sublessee or other transferee of the Original Owner/Operator's interest in the subject property or any portion thereof. In the event the Original Owner/Operator is no longer the owner and operator of the business located at the subject property, the permitted uses described in Condition No. 3 that are held on Fridays and Saturdays shall be allowed only between the hours of 9 a.m. and 12:00 a.m. (midnight), and no later. Planning and Building Department 5 Notwithstanding the preceding condition (i.e., Condition No. 3, permitting the Original Owner/Operator to use the premises for those permitted uses described in Condition No. 3 on Fridays and Saturdays between the hours of 9 a.m. and 12:30 a.m.), if the Planning Director determines, following consultation with the Police Chief (or his/her designee) and/or the Community Preservation Manager (or his/her designee), that use of the premises on Fridays and Saturdays beyond 12:00 a.m. (midnight) has resulted in an increase in calls for service to the subject property or has disturbed the peace and quiet of the residential neighborhood adjacent to the subject property, the Planning Director, in his/her discretion, shall have the authority to require the Original Owner/Operator to limit the use of the premises on Fridays and Saturdays to not later than 12:00 a.m. (midnight) following the giving of written notice to the Original Owner/Operator. The Original Owner/Operator shall promptly comply with such notice. This decision may be appealed to the Planning Commission as provided in Chapter 18.60 (Procedures). Planning and Building Department 6 Deejays, bands or any other form or live entertainment shall be limited to the following:  Sunday – Thursday: 9:00 a.m. to 10:00 p.m.  Friday/Saturday: 9:00 a.m. to midnight Police Department 7 The maximum sound level within the venue shall be maintained at 85 decibels or less. Planning and Building Department 8 Prior to removing tables and chairs from the theater for events, sound tests shall be conducted by City staff to determine if the existing permanent sound absorption solutions are sufficient. The Planning and Building Department - 9 - PC2016-*** NO. CONDITIONS OF APPROVAL RESPONSIBLE DEPARTMENT sound test will include playing recorded music at 85 decibels in the theater to discern whether the music is audible at the property line. If the music is audible, the tables and covers must remain or the business owner must make additional improvements until the noise is deemed by staff to be adequately mitigated. The property owner shall pay for all City staff costs associated with the monitoring. 9 Ticketed concert or musical events or any concert or musical event open to the general public shall not be held in any restaurant/banquet area. Planning and Building Department 10 Concurrent events are permitted in the theater and main dining room subject to the following:  Guests entering and exiting the theater area shall be physically separated from guests attending an event in the main dining room.  If City staff determines that holding events in both the theater and main dining room results in a parking deficiency, staff will immediately contact the operator and concurrent events will no longer be permitted until and unless the operator makes alternate parking arrangements, such as executing a shared parking agreement with an adjacent property. Until such alternate parking arrangements are made, the following limitations to concurrent events shall apply:  During an event in the theater, up to 175 restaurant patrons are permitted.  During an event in the theater, a private event shall not be held in the main dining room.  During an event in the theater and a private event in the small banquet room, the restaurant shall not be open to the public. Planning and Building Department 11 Events taking place on the same day shall be scheduled a minimum of two hours apart in order to ensure an adequate number of on-site parking spaces and adequate traffic flow. Planning and Building Department 12 The number of persons admitted shall not exceed 990 guests for events held within the theatre portion of the venue. Planning and Building Department 13 If noise complaints are received, and are validated by City staff, the applicant must cease operation of the noise source until such time that additional measures are implemented to eliminate the noise. Planning and Building Department 14 Trash shall not be emptied into outside trash containers between the hours of 10:00 p.m. and 7:00 a.m. Planning and Building Department 15 A chain or other barrier/barricade shall be maintained at either end of the south drive aisle from one hour before to one hour after events to prohibit cars and buses from driving through or parking in this area. Planning and Building Department - 10 - PC2016-*** NO. CONDITIONS OF APPROVAL RESPONSIBLE DEPARTMENT 16 The permitted event or activity shall not create sound levels that violate any ordinance of the City of Anaheim. Planning and Building Department 17 The Parking Management Plan is subject to continuous review by the Planning and Building Department and Public Works, Traffic and Transportation Division. The plan shall include measures to ensure that the parking of vehicles and valet activities do not affect traffic on Harbor Boulevard and do not cause a disturbance to the residential neighbors. Planning and Building Department, Public Works Department 18 The business owner shall require that any valet operator review the Parking Management Plan and conditions of approval pertaining to valet operations and sign an agreement that they will comply with the requirements. Planning and Building Department 19 Valet attendants shall park vehicles in the numbered stalls reserved for valet. Valet attendants shall not rely upon chirping the key fobs to locate vehicles. Planning and Building Department 20 The valet stand shall be located at the west entry, as shown on the approved Parking Management Plan. Public Works Department, Traffic and Transportation Division 21 The ongoing ability for guests to self-park at no charge shall be clearly posted. Optional valet parking may also be provided. Planning and Building Department Public Works Department, Traffic and Transportation Division 22 The parking area immediately behind the building shall be reserved for employees. Guests are not permitted to park in this area. Planning and Building Department 23 No buses are allowed in the parking area on the east side of the property, or the drive aisle along the south side of the property, including, but not limited to, buses for tour companies or performers. Planning and Building Department 24 During events in the theater or banquet areas, parking lot attendants shall be present and direct all patrons to park on the premises. Planning and Building Department 25 The same security team for all events shall be provided by the business owner, utilizing a company approved by the Police Department. Customers hosting events at the facility are not permitted to employ or provide their own security, except for security that is in addition to the security team provided by the business owner. Police Department - 11 - PC2016-*** NO. CONDITIONS OF APPROVAL RESPONSIBLE DEPARTMENT 26 The Security Plan is subject to continuous review by the Police Department, Vice Detail. The plan shall include measures to deter unlawful conduct of employees and patrons, promote the safe and orderly assembly and movement of persons and vehicles, and to prevent disturbances to the neighborhood by excessive noise created by patrons entering or leaving the premises. Police Department 27 Any and all security officers provided shall comply with all State and Local ordinances regulating their services, including, without limitation, Chapter 11.5 of Division 3 of the California Business and Profession Code. Police Department 28 The eastern portion of the property shall be provided with enough lighting to illuminate and make clearly visible the presence of any person on or about the premises between dusk and 5:30 a.m. Police Department 29 All south and east facing doors shall remain closed at all times, except in case of an emergency. Security guards shall monitor the south and east doors during events to ensure that they remain closed. Police Department 30 Security personnel shall be responsible for maintaining orderly conduct and prompt exiting from the property. Police Department 31 Management shall e-mail a monthly calendar of entertainment/events to the Vice Detail, attention mmirwin@anaheim.net, prior to the start of each month. Alternatively, the operator shall consistently maintain an “Event Calendar” on the website for the business. Police Department 32 Any graffiti painted or marked upon the premises or on any adjacent area under the control of the licensee shall be removed or painted over within 24 hours of being applied. Planning and Building Department 33 Any television or film activity shall be limited to filming, recording or broadcasting events that are authorized by this conditional use permit. Planning and Building Department 34 As recommended by the updated parking analysis prepared by Kunzman Associates, Inc. (dated March 7, 2012), events shall commence no earlier than 9:00 a.m. Public Works 35 As required by the facility’s Type 47 (On-Sale-General – Eating Place) Alcohol Beverage Control license, at all times when the premise is open for business, the premise shall be maintained as a bona fide restaurant and shall provide a menu containing an assortment of food normally offered in a restaurant. Police Department 36 That subject alcoholic beverage license shall not be exchanged for a public premise (bar) type license nor shall the establishment be operated as a public premise as defined in Section 23039 of the Business and Professions Code. Police Department - 12 - PC2016-*** NO. CONDITIONS OF APPROVAL RESPONSIBLE DEPARTMENT 37 The sale of alcoholic beverages for consumption off the premise shall be prohibited. Police Department 38 There shall be no exterior advertising or sign of any kind or type, including advertising directed to the exterior from within, promoting or indicating the availability of alcoholic beverages. Interior displays of alcoholic beverages or signs which are clearly visible to the exterior shall constitute a violation of this condition. Police Department 39 The business shall not employ or permit any persons to solicit or encourage others, directly or indirectly, to buy them drinks in the licensed premises under any commission, percentage, salary, or other profit-sharing plan, scheme or conspiracy. (Section 24200.5 Alcoholic Beverage Control Act) Police Department 40 Petitioner shall not share any profits, or pay any percentage or commission to a promoter or any other person, based upon monies collected as a door charge, cover charge, or any other form of admission charge, including minimum drink orders, or the sale of drinks. Police Department 41 All employees and patrons shall be clothed in such a way as to not expose "specified anatomical areas" as explained in the Anaheim Municipal Code. Police Department 42 Petitioner(s) shall not require patrons to purchase a minimum number of drinks. Police Department 43 Entertainment is allowed only within the building. No entertainment, including band warm-up and rehearsal, is allowed in the parking lot. Police Department 44 The property shall not be operated as a “Dance Venue”, as defined in Section 18.92.070 of the Anaheim Municipal Code. Police Department 45 No minor under the age of sixteen (16) years shall be allowed to attend the dance or event, unless accompanied by a parent or guardian. Police Department 46 Managers, owners, bar tenders, and wait staff shall call the Department of Alcoholic Beverage Control and obtain LEAD (Licensee Education on Alcohol and Drugs) Training. The contact number is (714) 558-4101. Police Department 47 The business shall not be operated in such a way as to be detrimental to the public health, safety or welfare. Police Department 48 Any violation of the application, or any attached conditions, shall be sufficient grounds to revoke the permit, subject to a public hearing. Police Department 49 Signs shall be posted on the interior of the south and east facing exit doors stating “Do Not Open, Except in Emergencies.” Planning and Building Department 50 All guest parking spaces that may be used for valet service shall be marked with a number. The 34 parking spaces behind the building and closest to the south property line shall be marked “Employee.” Planning and Building Department - 13 - PC2016-*** NO. CONDITIONS OF APPROVAL RESPONSIBLE DEPARTMENT 51 Signs shall be posted at all exits stating “No alcohol beyond this point.” Police Department 52 When no events are held within the venue, the parking lot may be used for public parking, including charging a fee for parking. The business owner must provide a security guard to monitor the site when used for public parking. Planning and Building Department 53 When no events are held within the venue, the parking lot may be used for public parking, including charging a fee for parking. All other outdoor activities are prohibited, including, but not limited to, food trucks or carts, merchandise sales, or entertainment. Planning and Building Department 54 When no events are held within the venue, the parking lot may be used for public parking, including charging a fee for parking. No overnight parking of vehicles shall be allowed in conjunction with this use. Hours of operation for public parking shall be consistent with the permitted hours of operation for the venue, as described in Condition No. 1, above. Planning and Building Department GENERAL 55 The subject Property shall be developed substantially in accordance with plans and specifications submitted to the City of Anaheim by the petitioner and which plans are on file with the Planning and Building Department, and as conditioned herein. Planning and Building Department 56 The Applicant shall defend, indemnify, and hold harmless the City and its officials, officers, employees and agents (collectively referred to individually and collectively as “Indemnitees”) from any and all claims, actions or proceedings brought against Indemnitees to attack, review, set aside, void, or annul the decision of the Indemnitees concerning this permit or any of the proceedings, acts or determinations taken, done, or made prior to the decision, or to determine the reasonableness, legality or validity of any condition attached thereto. The Applicant’s indemnification is intended to include, but not be limited to, damages, fees and/or costs awarded against or incurred by Indemnitees and costs of suit, claim or litigation, including without limitation attorneys’ fees and other costs, liabilities and expenses incurred by Indemnitees in connection with such proceeding. Planning and Building Department 57 The applicant is responsible for paying all charges related to the processing of this discretionary case application within 30 days of the issuance of the final invoice or prior to the issuance of building permits for this project, whichever occurs first. Failure to pay all charges shall result in delays in the issuance of required permits or may result in the revocation of the approval of this application. Planning and Building Department ATTACHMENT NO. 2 ATTACHMENT NO. 3 ATTACHMENT NO. 4 1 Elaine Thienprasiddhi From:Michael Renzi <mrenzi55@gmail.com> Sent:Monday, November 21, 2016 1:11 PM To:Elaine Thienprasiddhi Subject:Conditional Use Permit 2010-05486G (DEV2009-00083G) Attachments:201611211241.pdf Ms. Elain Thienprasiddhi, Per the notice received via mail (attached), please cast my vote AGAINST the acceptance of this project, at the risk of negatively affecting my property value. My neighborhood is a quiet development insulated from the busy commerce conducted on Harbor Blvd., which ceases at early evening hours. This project threatens that peace, in that late night events will affect my communities solace and risk the potential market of future sales to a new buyer. Thank you for listening to the voice of the neighborhood. Sincerely, Michael Renzi 2314 S. Mira Ct #160 Anaheim, CA 92802 949‐289‐4844 mrenzi55@gmail.com Ú Ú Ú . m 7 ÚÚ.m7ÚÚÚÚ . m 7 ÚÚ.m7 BF= 43,500 sq. ft.PROPOSED DINNE R T H E A T E R N O R T H V EE E P E EP E EP EP E NBPNBPCENTERLINE OF HARBOR BOULEVARDCITY OF ANAHEIMCITY OF GARDEN GROVE NBP N B P NBP N P D E NBP GENERAL CIRCULATIONAVAILABILITY LARGE AND SMALL BUSCIRCULATION PLAN TODROP-OFF/ BOARD CUSTOMERSLARGE & SMALL BUSES ENTER ATSOUTH DRIVE APPROACH ANDPROCEED TO DROP-OFF AREABETWEEN 7:00 AND 11:30 AMBUSES THEN LOAD CUSTOMERS &EXIT VIA R.H. TURN ONTO HARBORBLVD. TO ACQUIRE FREEWAY(S)FUNCTION:SYMBOL LEGEND:BIG BUS BACKINGSMALL BUS BACKINGALTERNATIVE ENTRY PLANDURING PERFORMANCEINDEX OF SHEETS:EV1 PASSENGERS DROP-OFF AND PICK-UP PLANEV2 FLOOR PLAN/ SEATING ARRANGEMENT # 2 4 + . # 5 0 1 6 ' & PASSENGER DR O P - O F F A N D P I C K - U P P L A N E V 1 / < . R E M O D E L F L O O R S P A C E ( M I N O R ) O F A N E X I S T I N G 4 3 , 5 0 0 S . F . D I N N E R T H E A T R E I N C L U D I N G : S I T E D A T A : P A R K I N G D A T A : S P A C E S R E Q U I R E D S P A C E S P R O V I D E D B U S P A R K I N G P R O V I D E D T O T A L P A R K I N G P R O V I D E D B U I L D I N G D A T A : O C C U P A N T L O A D F A C T O R : V I C I N I T Y M A P D E T A I L 3 D E T A I L 4 D E T A I L 5 I N D E S E N G I N C . M3 LIVE CONCERT AND EVENT CENTER A T T A C H M E N T N O . 5 EXIT E X I T E X I T E X I T E X I T E X I T E X I T EXIT EXIT EXIT EXIT E X I T EXITEXIT EXIT EXITEXIT # 2 4 + . # 5 0 1 6 ' & / < . FLOOR PLAN E V 2 I N D E S E N G I N C . M3 LIVE CONCERT AND EVENT CENTER 200 S. Anaheim Blvd. Suite #162 Anaheim, CA 92805 Tel: (714) 765-5139 Fax: (714) 765-5280 www.anaheim.net City of Anaheim PLANNING DEPARTMENT There is no new correspondence regarding this item. 200 S. Anaheim Blvd. Suite #162 Anaheim, CA 92805 Tel: (714) 765-5139 Fax: (714) 765-5280 www.anaheim.net ITEM NO. 3 PLANNING COMMISSION REPORT City of Anaheim PLANNING AND BUILDING DEPARTMENT DATE: NOVEMBER 28, 2016 SUBJECT: RECLASSIFICATION NO. 2014-00275 AND TENTATIVE PARCEL MAP NO. 2014-176 LOCATION: 5055 East Short Street APPLICANT/PROPERTY OWNER: The applicant and property owner is Steven Dunbar, represented by John Ramirez with MLJ Resources, LLC. REQUEST: The following land use entitlements are being requested: 1) A Reclassification, or rezoning, of property from the “T” Transition Zone to the “RS-3” Single-Family Residential Zone; and 2) A Tentative Parcel Map to subdivide the property into four single- family residential lots. RECOMMENDATION: Staff recommends that the Planning Commission adopt the attached resolutions, determining that this request is categorically exempt from further environmental review under the California Environmental Quality Act (CEQA) under Class 15 (Minor Land Divisions) of the State CEQA Guidelines, and approving Reclassification No. 2014-00275 and Tentative Parcel Map No. 2014-176. BACKGROUND: The subject property is located in the “T” Transition Zone and currently consists of a 0.55-acre undeveloped parcel. The General Plan designates the property for Low Density Residential land uses. The existing "T" zoning designation represents land that is used for agricultural uses, in a transitory or interim use, restricted to limited uses because of special conditions, or not zoned to one of the zoning districts in the Zoning Code. The property is surrounded by single family homes on all four sides (within the City of Yorba Linda to the west and across Imperial Highway to the north). RECLASSIFICATION NO. 2014-00275 AND TENTATIVE PARCEL MAP NO. 2014-176 November 28, 2016 Page 2 of 4 PROPOSAL: The applicant requests that the City vacate 0.16 acres of public right-of-way and proposes to rezone the property from the "T" Transition Zone to the "RS-3" Single-Family Residential Zone in order to subdivide the property and to allow for the future contruction of four detached single-family homes on the 0.71-acre project area. AERIAL PHOTO The proposed lot sizes would be 10,774 square feet for Parcel 1; 7,811 square feet for Parcel 2; 5,484 square feet for Parcel 3; and 6,973 square feet for Parcel 4. The Zoning Code requires a minimum lot size of 5,000 square feet in the RS-3 Zone. The proposed subdivision of the property would, therefore, conform with the minimum lot size requirements once the property has been reclassified. No improvements on the resulting four lots are proposed as a part of this request. FINDINGS AND ANALYSIS: Following is staff’s analysis and recommendation for each requested action: Reclassification: The property is currently located in the “T” Transition Zone. A reclassification, or rezoning, to the “RS-3” Single Family Residential Zone is being requested in RECLASSIFICATION NO. 2014-00275 AND TENTATIVE PARCEL MAP NO. 2014-176 November 28, 2016 Page 3 of 4 order to allow a four lot subdivision for the future development of four detached single-family homes. The RS-3 zoning requires a minimum lot size of 5,000 square feet and a minimum lot width of 50 feet. The proposed four lot subdivision would result in lot sizes of 10,744; 7,811; 5,484; and 6,973 square feet, with 85, 85, 57, and 62 foot wide frontages, respectively, in conformance with the RS-3 Zone. The intent of the RS-3 Zone is to promote the development of attractive, safe and healthy residential uses, and to promote development that integrates with and minimizes impacts to surrounding land uses. The 5.6 dwelling units per acre density of the proposed project is consistent with the City’s General Plan land use designation of Low Density Residential, which allows up to 6.5 dwelling units per acre, and will be compatible with the surrounding land uses and zoning. The proposed reclassification supports several General Plan goals intended to (i) provide a variety of quality housing opportunities to address the City’s diverse housing needs and (ii) facilitate new residential development on vacant or underutilized infill parcels. Therefore, staff recommends approval of the reclassification request. Tentative Parcel Map: Before the Planning Commission may approve the tentative parcel map, it must make a finding of fact that the evidence presented shows that all of the following conditions exist: 1) That the proposed subdivision of the Property, including its design and improvements, is consistent with the General Plan of the City of Anaheim. 2) That the proposed subdivision of the Property, as shown on Tentative Parcel Map No. 2014-176, including their design and improvements, is consistent with the zoning and development standards of the proposed "RS-3" Single-Family Residential Zone being proposed in conjunction with Reclassification No. 2014-00275. 3) That the site is physically suitable for the type and density of the proposed project. 4) That the design of the subdivision, as shown on Tentative Parcel Map No. 2014-176, is not likely to cause substantial environmental damage or substantially and avoidably injure fish or wildlife or their habitat. 5) That the design of the subdivision, as shown on Tentative Parcel Map No. 2014-176, or the type of improvements is not likely to cause serious public health problems. 6) That the design of the subdivision, as shown on Tentative Parcel Map No. 2014-176, or the type of improvements will not conflict with easements acquired by the public, at large, for access through or use of property within the proposed subdivision. A tentative parcel map is required to subdivide the existing parcel into four lots. The proposed subdivision would create four new lots that would exceed the minimum lot size of 5,000 square feet in the RS-3 Zone. The proposed subdivision would also meet the minimum lot width requirement of 50 feet for the RS-3 Zone. A future proposal for single-family residences on the newly-created lots would be required to be developed in accordance with the development standards of the RS-3 Zone. The proposed lot sizes are compatible with the lot sizes of other RECLASSIFICATION NO. 2014-00275 AND TENTATIVE PARCEL MAP NO. 2014-176 November 28, 2016 Page 4 of 4 single-family residential properties in the immediate vicinity. Therefore, staff recommends approval of the proposed tentative parcel map. Environmental Impact Analysis: Staff recommends that the Planning Commission find and determine that the effects of the division of the property into four lots are typical of those generated within that class of projects (i.e., Class 15 – Minor Land Divisions) meeting the conditions described in Section 15315 of Title 14 of the California Code of Regulations (the "CEQA Guidelines"), which consist of the division of property in urbanized areas zoned for residential, commercial, or industrial use into four or fewer parcels when the division is in conformance with the General Plan and zoning, no variances or exceptions are required, all services and access to the proposed parcels to local standards are available, the parcel was not involved in a division of a larger parcel within the previous 2 years, and the parcel does not have an average slope greater than 20 percent and that, therefore, pursuant to Section 15315 of the CEQA Guidelines, the proposed division of the property will not cause a significant effect on the environment and is, therefore, categorically exempt from the provisions of CEQA. CONCLUSION: The proposed reclassification of the properties from the “T” Transition Zone to "RS-3" Single-Family Residential Zone is consistent with the goals of the General Plan and would be consistent with site development standards for the "RS-3" Single-Family Residential Zone, and the uses are compatible with the single-family residential uses surrounding the property. Therefore, staff recommends approval of the reclassification and tentative parcel map. Prepared by, Submitted by, Nick Taylor Jonathan E. Borrego Associate Planner Planning Services Manager Attachments: 1. Draft Reclassification Resolution 2. Draft Tentative Parcel Map Resolution 3. Applicant’s Letter of Request 4. Tentative Parcel Map 5. Site Photographs T TESPERANZAHIGH SCHOOL TO.C.F.C.D. RS-3S.F.R.RS-3S.F.R. RS-3S.F.R. TS.F.R.TS.F.R. RS-3S.F.R.RS-3S.F.R. RS-3S.F.R. RS-3S.F.R. RS-3S.F.R. K E L L O G G D R YORBA LINDA FWY N K E L L O G G D R N IMPERIAL HWY SHORT ST E SHORT ST C A L L E M I R A D O R E CRESTHILL DR N P I N E C O V E C I R E P A S E O D E G R A C EN BRANDON CIR N.IMPERIAL H W Y E.ORANGETHORPEAVE S . R I C H F I E L D R D 5055 East Short Street DEV No. 2014-00130 Subject Property APN: 343-522-03343-522-07343-522-02 °0 50 100 Feet Aerial Photo:June 2015 K E L L O G G D R YORBA LINDA FWY N K E L L O G G D R N IMPERIAL HWY SHORT ST E SHORT ST C A L L E M I R A D O R E CRESTHILL DR N P I N E C O V E C I R E P A S E O D E G R A C EN BRANDON CIR N.IMPERIAL H W Y E.ORANGETHORPEAVE S . R I C H F I E L D R D 5055 East Short Street DEV No. 2014-00130 Subject Property APN: 343-522-03343-522-07343-522-02 °0 50 100 Feet Aerial Photo:June 2015 [DRAFT] ATTACHMENT NO. 1 - 1 - PC2016-*** RESOLUTION NO. PC2016-*** A RESOLUTION OF THE ANAHEIM PLANNING COMMISSION APPROVING RECLASSIFICATION NO. 2014-00275 AND MAKING CERTAIN FINDINGS IN CONNECTION THEREWITH (DEV2014-00130) (5055 EAST SHORT STREET) WHEREAS, the Planning Commission of the City of Anaheim (the "Planning Commission") did receive a verified petition to rezone or reclassify that certain real property located at 5055 East Short Street in the City of Anaheim, County of Orange, State of California, as generally depicted on the map attached hereto as Exhibit A and incorporated herein by this reference (the "Property") from the "T" Transition Zone to the “RS-3” Single-Family Residential Zone, which reclassification is designated as Reclassification No. 2014-00275; and WHEREAS, the Property is currently undeveloped and is located in the "T" Transition Zone. The Anaheim General Plan designates the Property for Low Density Residential land uses; and WHEREAS, Reclassification No. 2014-00275 is proposed in conjunction with Tentative Parcel Map No. 2016-176. Tentative Parcel Map No. 2014-176 would establish a 4- lot residential subdivision on the Property. Reclassification No. 2014-00275 and Tentative Parcel Map No. 2014-176, shall be referred to herein collectively as the "Proposed Project"; and WHEREAS, on November 28, 2016, the Planning Commission did hold a public hearing at the Civic Center in the City of Anaheim, notice of said public hearing having been duly given as required by law and in accordance with the provisions of Chapter 18.60 (Procedures) of the Anaheim Municipal Code (the "Code"), to hear and consider evidence for and against proposed Reclassification No. 2014-00275 and Tentative Parcel Map No. 2014-176 and to investigate and make findings and recommendations in connection therewith; and WHEREAS, pursuant to and in accordance with the provisions of the California Environmental Quality Act (Public Resources Code Section 21000 et seq.; herein referred to as “CEQA”), the State of California Guidelines for Implementation of the California Environmental Quality Act (herein referred to as the "CEQA Guidelines"), and the City's Local CEQA Procedure Manual, the City is the "lead agency" for the preparation and consideration of environmental documents for "projects", as that term is defined in Section 15378 of the CEQA Guidelines; and WHEREAS, the Planning Commission finds and determines that the Proposed Project is within that class of projects (i.e., Class 15 – Minor Land Divisions) which consists of the division of property meeting the conditions described in Section 15315 of the CEQA Guidelines; that is, (a) consists of the division of property in urbanized areas zoned for residential, commercial, or industrial use into four or fewer parcels when the division is in conformance with the General Plan and zoning, (b) no variances or exceptions are required, (c) all services and access to the proposed parcels to local standards are available, (d) the parcel was not involved in a division of a larger parcel within the previous 2 years, and (e) the parcel does - 2 - PC2016-*** not have an average slope greater than 20 percent. The Planning Commission finds and determines that the Property is located within an "urbanized area", as that term is defined in Section 15387 of the CEQA Guidelines, and meets the aforementioned conditions and will not cause a significant effect on the environment and is, therefore, categorically exempt from the provisions of CEQA; and WHEREAS, the Planning Commission, after due inspection, investigation and study made by itself and in its behalf, and after due consideration of all evidence and reports offered at said hearing, does find and determine the following facts: 1. Reclassification of the Property from the "T" Transition Zone to the "RS-3" Single-Family Residential Zone is consistent with the Property’s existing Low Density Residential land use designation in the General Plan. 2. The proposed reclassification of the Property is necessary and/or desirable for the orderly and proper development of the community and is compatible with the adjacent properties to the north, south, east and west, which are developed with single family homes. 3. The proposed reclassification of the Property does properly relate to the zone and its permitted uses locally established in close proximity to the Property and to the zones and their permitted uses generally established throughout the community in that surrounding properties located within the boundaries of the City of Anaheim include single family residential uses within the “RS-3” Single-Family Residential Zone. WHEREAS, the Planning Commission determines that the evidence in the record constitutes substantial evidence to support the actions taken and the findings made in this Resolution, that the facts stated in this Resolution are supported by substantial evidence in the record, including testimony received at the public hearing, the staff presentations, the staff report and all materials in the project files. There is no substantial evidence, nor are there other facts, that detract from the findings made in this Resolution. The Planning Commission expressly declares that it considered all evidence presented and reached these findings after due consideration of all evidence presented to it. NOW, THEREFORE, BE IT RESOLVED that, pursuant to the above findings, this Planning Commission does hereby approve Reclassification No. 2014-00275 to authorize an amendment to the Zoning Map of the Anaheim Municipal Code to rezone and reclassify the Property into the "RS-3" Single-Family Residential Zone and recommends that the City Council adopt an ordinance reclassifying the Property in accordance with Reclassification No. 2014- 00275. BE IT FURTHER RESOLVED that this Resolution shall not constitute a rezoning of, or a commitment by the City to rezone, the Property; any such rezoning shall require an ordinance of the City Council, which shall be a legislative act, which may be approved or denied by the City Council at its sole discretion. - 3 - PC2016-*** THE FOREGOING RESOLUTION was adopted at the Planning Commission meeting of November 28, 2016. CHAIRPERSON, PLANNING COMMISSION OF THE CITY OF ANAHEIM ATTEST: SECRETARY, PLANNING COMMISSION OF THE CITY OF ANAHEIM STATE OF CALIFORNIA ) COUNTY OF ORANGE ) ss. CITY OF ANAHEIM ) I, Eleanor Morris, Secretary of the Planning Commission of the City of Anaheim, do hereby certify that the foregoing resolution was passed and adopted at a meeting of the Planning Commission of the City of Anaheim held on November 28, 2016, by the following vote of the members thereof: AYES: COMMISSIONERS: NOES: COMMISSIONERS: ABSENT: COMMISSIONERS: IN WITNESS WHEREOF, I have hereunto set my hand this 28th day of November, 2016. SECRETARY, PLANNING COMMISSION OF THE CITY OF ANAHEIM - 4 - PC2016-*** [DRAFT] ATTACHMENT NO. 2 - 1 - PC2016-*** RESOLUTION NO. PC2016-*** A RESOLUTION OF THE PLANNING COMMISSION OF THE CITY OF ANAHEIM APPROVING TENTATIVE PARCEL MAP NO. 2014-176 AND MAKING CERTAIN FINDINGS IN CONNECTION THEREWITH (DEV2014-00130) (5055 EAST SHORT STREET) WHEREAS, the Planning Commission of the City of Anaheim (the "Planning Commission") did receive a verified petition to approve Tentative Parcel Map No. 2014-176 to establish a 4-lot residential subdivision for that certain real property located at 5055 East Short Street, in the City of Anaheim, County of Orange, State of California, as generally depicted on Exhibit A attached hereto and incorporated herein by this reference (the "Property"); and WHEREAS, the Property is currently undeveloped and is located in the "T" Transition Zone. Tentative Parcel Map No. 2014-176 is proposed in conjunction with Reclassification No. 2014-00275, which is a request to rezone or reclassify the Property from the "T" Transition Zone to the "RS-3" Single-Family Residential Zone (herein referred to as "Reclassification No. 2014-00275"). The Anaheim General Plan designates this Property for Low Density Residential land uses; and WHEREAS, the applicant requests a tentative parcel map in order to establish a 4- lot residential subdivision on the Property. The applicant has no current plans to construct single-family residential dwelling units on the four parcels to be established by Tentative Parcel Map No. 2014-176; and WHEREAS, on November 28, 2016, the Planning Commission did hold a public hearing at the Civic Center in the City of Anaheim, notice of said public hearing having been duly given as required by law and in accordance with the provisions of Chapter 18.60 (Procedures) of the Anaheim Municipal Code (the "Code"), to hear and consider evidence for and against said proposed Tentative Parcel Map 2014-176 and Reclassification No. 2014-00275 and to investigate and make findings and recommendations in connection therewith; and WHEREAS, pursuant to and in accordance with the provisions of the California Environmental Quality Act (Public Resources Code Section 21000 et seq.; herein referred to as “CEQA”), the State of California Guidelines for Implementation of the California Environmental Quality Act (herein referred to as the "CEQA Guidelines"), and the City's Local CEQA Procedure Manual, the City is the "lead agency" for the preparation and consideration of environmental documents for "projects", as that term is defined in Section 15378 of the CEQA Guidelines; and WHEREAS, by the adoption of a separate resolution concurrently with but prior in time to this Resolution, this Planning Commission has found and determined that the Proposed Project will not cause a significant effect on the environment and is, therefore, categorically exempt from the provisions of CEQA; and - 2 - PC2016-*** WHEREAS, the Planning Commission, after due inspection, investigation and study made by itself and in its behalf, and after due consideration of all evidence and reports offered at said hearing with respect to the request to establish a 4-lot residential subdivision, does find and determine the following facts: 1. The proposed subdivision, including its design and improvements, and with the conditions imposed herein is consistent with the Low Density Residential land use designation in the Anaheim General Plan and the development standards contained in the "RS-3" Single-Family Residential Zone in that the proposed parcel map will create four lots which exceed the minimum 5,000 square foot lot size for the “RS-3” zone (Lot 1 – 10,774 square feet, Lot 2 – 7,811 square feet, Lot 3 – 5,484 square feet, Lot 4 – 6,973 square feet). The proposed lots are consistent with the proposed zoning and the existing General Plan land use designation. 2. The site is physically suitable for the type and size of the proposed residential subdivision in that this relatively flat lot is currently undeveloped and is of adequate size to subdivide into four conforming parcels that can be developed in accordance with the development standards of the "RS-3" Single-Family Residential Zone. 3. The design of the subdivision, with the conditions imposed, is not likely to cause substantial environmental damage or substantially and avoidably injure fish or wildlife or their habitat because no sensitive environmental habitat has been identified on the site in that no environmental impacts are anticipated as part of the future development of single-family residential uses on this property. 4. The design of the subdivision or the type of improvements is not likely to cause serious public health problems, since any new structures and associated site improvements will be constructed on the property in compliance with the conditions imposed and other related Code requirements in that future development of single-family residences will be subject to all City code requirements for demolition and construction. 5. The design of the subdivision or the type of improvements will not conflict with easements, acquired by the public at large, for access through or use of property within the proposed subdivision in that the parcel map is conditioned to be submitted for review and approval to the City of Anaheim and the Orange County Surveyor and then shall be recorded in the Office of the Orange County Recorder prior to issuance of building permits. WHEREAS, the Planning Commission determines that the evidence in the record constitutes substantial evidence to support the actions taken and the findings made in this Resolution, that the facts stated in this Resolution are supported by substantial evidence in the record, including testimony received at the public hearing, the staff presentations, the staff report and all materials in the project files. There is no substantial evidence, nor are there other facts, that detract from the findings made in this Resolution. The Planning Commission expressly declares that it considered all evidence presented and reached these findings after due consideration of all evidence presented to it. - 3 - PC2016-*** NOW, THEREFORE, BE IT RESOLVED that the Planning Commission does hereby approve Tentative Parcel Map No. 2014-176, subject to and contingent upon (1) the adoption by the City Council of an ordinance reclassifying the Property within the "RS-3" Single-Family Residential Zone in accordance with Reclassification No. 2014-00275, (2) the conditions of approval described in Exhibit B attached hereto and incorporated herein by this reference, which are hereby found to be a necessary prerequisite to the proposed use of the Property in order to preserve the health, safety and general welfare of the citizens of the City of Anaheim. Extensions for further time to complete conditions of approval may be granted in accordance with Section 18.60.170 of the Code. Timing for compliance with conditions of approval may be amended by the Planning Director upon a showing of good cause provided (i) equivalent timing is established that satisfies the original intent and purpose of the condition(s), (ii) the modification complies with the Code, and (iii) the applicant has demonstrated significant progress toward establishment of the use or approved development. BE IT FURTHER RESOLVED that the Planning Commission does hereby find and determine that adoption of this Resolution is expressly predicated upon applicant's compliance with each and all of the conditions hereinabove set forth. Should any such condition, or any part thereof, be declared invalid or unenforceable by the final judgment of any court of competent jurisdiction, then this Resolution, and any approvals herein contained, shall be deemed null and void. BE IT FURTHER RESOLVED that approval of this application constitutes approval of the proposed request only to the extent that it complies with the Anaheim Municipal Code and any other applicable City, State and Federal regulations. Approval does not include any action or findings as to compliance or approval of the request regarding any other applicable ordinance, regulation or requirement. THE FOREGOING RESOLUTION was adopted at the Planning Commission meeting of November 28, 2016. Said resolution is subject to the appeal provisions set forth in Chapter 18.60 (Procedures) of the Anaheim Municipal Code pertaining to appeal procedures and may be replaced by a City Council Resolution in the event of an appeal. CHAIRPERSON, PLANNING COMMISSION OF THE CITY OF ANAHEIM ATTEST: SECRETARY, PLANNING COMMISSION OF THE CITY OF ANAHEIM - 4 - PC2016-*** STATE OF CALIFORNIA ) COUNTY OF ORANGE ) ss. CITY OF ANAHEIM ) I, Eleanor Morris, Secretary of the Planning Commission of the City of Anaheim, do hereby certify that the foregoing resolution was passed and adopted at a meeting of the Planning Commission of the City of Anaheim held on November 28, 2016, by the following vote of the members thereof: AYES: COMMISSIONERS: NOES: COMMISSIONERS: ABSENT: COMMISSIONERS: IN WITNESS WHEREOF, I have hereunto set my hand this 28th day of November, 2016. SECRETARY, PLANNING COMMISSION OF THE CITY OF ANAHEIM - 5 - PC2016-*** - 6 - PC2016-*** EXHIBIT “B” TENTATIVE PARCEL MAP NO. 2014-176 (DEV2014-00130) NO. CONDITIONS OF APPROVAL RESPONSIBLE DEPARTMENT PRIOR TO FINAL MAP APPROVAL 1 An improvement certificate shall be placed on the Parcel Map to indicate that all street improvements along Short street, Kellogg Drive and the Off Ramp shall be constructed per the latest version of City of Anaheim Public Works Standards and shall be constructed prior to final building and zoning inspections as directed by the City Engineer for future building or grading site development plans. Public Works Department, Development Services Division 2 An improvement certificate shall be placed on the Parcel Map to indicate that all required public sewer and storm drain improvements and any other City-owned public utilities shall be constructed prior to final building and zoning inspections as directed by the City Engineer for future building or grading site development plans. Public Works Department, Development Services Division 3 The legal property owner shall irrevocably offer to dedicate to the City of Anaheim, on the Parcel Map, an easement 45 feet from the centerline of Kellogg Drive and a corner cutoff as required and approved by the City Engineer. Public Works Department, Development Services Division 4 The Parcel Map shall be submitted to and approved by the City of Anaheim and the Orange County Surveyor and then shall be filed in the Office of the Orange County Recorder. Public Works Department, Development Services Division 5 Short Street right-of-way abandonment/vacation shall be subject to City Council approval. The developer shall submit the necessary document(s) to the City for review and approval. Public Works Department, Development Services Division 6 The developer shall provide a Monumentation Bond in an amount specified in writing by a Licensed Land Surveyor of Record. Public Works Department, Development Services Division 7 The developer shall comply with all applicable requirements of the Anaheim Municipal Code. Public Works Department, Development Services Division 8 The developer shall provide the Base Flood Elevation. Public Works Department, Development Services Division - 7 - PC2016-*** NO. CONDITIONS OF APPROVAL RESPONSIBLE DEPARTMENT 9 A maintenance covenant, shall be submitted, prior to building or grading permit issuance, to the Subdivision Section of Public Works and approved by the City Attorney's office. The covenant shall include provisions for maintenance of private facilities, including compliance with approved Water Quality Management Plan if any, and a maintenance exhibit. Maintenance responsibilities shall include but not limited to parkway landscaping and irrigation on Short street, Kellogg Drive and the Off Ramp. The covenant shall be recorded in the Office of the Orange County Recorder. Public Works Department, Development Services Division PRIOR TO RECORDATION OF THE PARCEL MAP 10 The developer shall demonstrate that all building pads will be a minimum of 1-foot above the base flood elevation. The developer shall provide an elevation certificate issued by FEMA, or other materials determined to be sufficient by Planning Services Division staff. Planning and Building Department, Planning Services Division GENERAL 11 The Applicant shall defend, indemnify, and hold harmless the City and its officials, officers, employees and agents (collectively referred to individually and collectively as “Indemnitees”) from any and all claims, actions or proceedings brought against Indemnitees to attack, review, set aside, void, or annul the decision of the Indemnitees concerning this permit or any of the proceedings, acts or determinations taken, done, or made prior to the decision, or to determine the reasonableness, legality or validity of any condition attached thereto. The Applicant’s indemnification is intended to include, but not be limited to, damages, fees and/or costs awarded against or incurred by Indemnitees and costs of suit, claim or litigation, including without limitation attorneys’ fees and other costs, liabilities and expenses incurred by Indemnitees in connection with such proceeding. Planning and Building Department, Planning Services Division 12 The applicant is responsible for paying all charges related to the processing of this discretionary case application within 30 days of the issuance of the final invoice or prior to the issuance of building permits for this project, whichever occurs first. Failure to pay all charges shall result in delays in the issuance of required permits or may result in the revocation of the approval of this application. Planning and Building Department, Planning Services Division 13 The property shall be developed substantially in accordance with plans and specifications submitted to the City of Anaheim by the applicant and which plans are on file with the Planning Department. Planning and Building Department, Planning Services Division April 18, 2016 City of Anaheim Planning & Building Department Attn: Nicholas J. Taylor Associate Planner 200 South Anaheim Boulevard, Suite 162 Anaheim CA 92805 Subject: Letter of Request/Project Description - 5055 East Short Street Dear Mr. Taylor, This application request is for a Reclassification of a vacant, 0.66-acre property from the Transitional (T) zone to the Single Family Residential (RS-3) zone (minimum lot size of 5,000 square feet). A four-lot subdivision (tentative parcel map) is being requested in conjunction with the reclassification. The site was developed with a detached garage and a smaller accessory structure and is currently vacant. The Reclassification request would change the zoning of the property to the Single Family Residential (RS-3) zone (minimum lot size of 5,000 square feet) to build a four-lot subdivision. The current Transitional Zone is not consistent with General Plan designation for the site and the reclassification to the RS-3 zone would bring the property zoning into conformance with the General Plan designation. The intent of the “RS-3” Single- Family Residential Zone is to provide an attractive, safe, and healthy environment with single-family dwelling units on a minimum lot size of five thousand (5,000) square feet. The proposed zone implements the Low Density Residential and Low- Medium Hillside Density Residential land use designations in the General Plan. The four newly created lots would comply with the minimum standards of the RS-3 Zone. As a result of this project, the site will be brought into conformance with the General Plan and will be developed with four new single family homes consistent with the adjacent residential neighborhoods. Please let me know if you have any questions or if further information is needed. You can reach me at 562-818-6719 or john@mljresources.com . Regards, John P. Ramirez, AICP Principal ATTACHMENT NO. 3 A T T A C H M E N T N O . 4 ATTACHMENT NO. 5 200 S. Anaheim Blvd. Suite #162 Anaheim, CA 92805 Tel: (714) 765-5139 Fax: (714) 765-5280 www.anaheim.net City of Anaheim PLANNING DEPARTMENT There is no new correspondence regarding this item. 200 S. Anaheim Blvd. Suite #162 Anaheim, CA 92805 Tel: (714) 765-5139 Fax: (714) 765-5280 www.anaheim.net ITEM NO. 4 PLANNING COMMISSION REPORT City of Anaheim PLANNING AND BUILDING DEPARTMENT DATE: NOVEMBER 28, 2016 SUBJECT: CONDITIONAL USE PERMIT NO. 2016-05860 CONDITIONAL USE PERMIT NO. 2016-05890 VARIANCE NO. 2016-05066 DETERMINATION OF PUBLIC CONVENIENCE OR NECESSITY NO. 2016-00131 LOCATION: PARCEL A - 2210 and 2220 East Orangewood Avenue PARCEL B - 2130 East Orangewood Avenue APPLICANT/PROPERTY OWNER: PARCEL A - The applicant is Golden Road Brewing represented by Brandon Smith and the property owner is Custom Craft Beer, LLC. PARCEL B - The applicant is Golden Road Brewing represented by Brandon Smith and the property owner is Trevor Tait. REQUEST: The applicant is requesting approval of the following entitlements: PARCEL A- 1) A conditional use permit to permit the construction of a brew pub to include an event space, an outdoor dining and recreational/entertainment area with on and off-premises sales and consumption of alcoholic beverages and a coordinated sign program. 2) A variance to allow fewer parking spaces than required by the Zoning Code. 3) A determination of public convenience or necessity to permit a brew pub with on and off-premises sales and consumption of alcoholic beverages. PARCEL B- 1) A conditional use permit to allow off-site parking for a brew pub. CONDITIONAL USE PERMIT NO. 2016-05860, CONDITIONAL USE PERMIT NO. 2016-05890, VARIANCE NO. 2016-05066 AND DETERMINATION OF PUBLIC CONVENIENCE OR NECESSITY NO. 2016-00131 November 28, 2016 Page 2 of 9 RECOMMENDATION: Staff recommends that the Planning Commission approve the attached resolutions, determining that this request is categorically exempt under the California Environmental Quality Act (Class 32, In-Fill Development Projects), and approving Conditional Use Permit No. 2016-05860, Conditional Use Permit No. 2016-05890, Variance No. 2016-05066 and Determination of Public Convenience or Necessity No. 2016-00131. BACKGROUND: PARCEL A- This 2.5-acre property is developed with a 58,500 square foot industrial building that is used for alcohol beverage manufacturing (a brewery) and includes a small tasting room. The property is located in the Platinum Triangle within the underlying “I” Industrial Zone and the “PTMU” Platinum Triangle Mixed Use Overlay Zone. The General Plan designates the property for Mixed Use land uses. Surrounding land uses include The George Apartments, currently under construction, and Angel Stadium across Orangewood Avenue to the north, and, industrial businesses to the south and across Dupont Drive to the east and west, including Parcel B described below. Conditional Use Permit No. 2015-05811 was approved by the Planning Commission on August 10, 2015 to permit a tasting room with an outdoor patio within a portion of an existing industrial building with fewer parking spaces than required by the Zoning Code. The intent of this tasting room was to allow a temporary facility for customers to preview and taste specialty beers while the applicant prepared plans for the permanent brewing, restaurant and tasting room operations. Staff is recommending a condition of approval that this permit be terminated if the subject project is approved. Alcoholic Beverage Manufacturing is permitted by right at this location by the underlying Industrial Zone. PARCEL B- This 1.3-acre property is developed with an industrial building and is located in the Platinum Triangle within the underlying “I” Industrial Zone and the “PTMU” Platinum Triangle Mixed Use Overlay Zone. The General Plan designates the property for Mixed Use land uses. Surrounding land uses include vacant land approved for mixed use development (the LT Platinum Project) across Orangewood Avenue to the north; industrial businesses, including Parcel A (described above), across Dupont Drive to the east; industrial businesses to the south; and the Gateway Apartment Homes to the west. This project was continued from the November 14, 2016 Planning Commission meeting in order for the project to be re-advertised to include a request for approval of a coordinated sign program and to delete the request for a development agreement because it was no longer applicable to the proposed project. PROPOSAL: The applicant is proposing to partially demolish and construct improvements to the existing 58,500 square foot industrial building/brewery located on Parcel A. The eastern half of the building would undergo a phased demolition to include the removal of the roof and three walls, leaving the existing slab as a temporary construction staging area. The foundation would eventually be demolished for the establishment of an outdoor dining, entertainment and recreation area. The remaining structure would largely be left intact, with areas of selective demolition to provide new building openings and interior improvements. CONDITIONAL USE PERMIT NO. 2016-05860, CONDITIONAL USE PERMIT NO. 2016-05890, VARIANCE NO. 2016-05066 AND DETERMINATION OF PUBLIC CONVENIENCE OR NECESSITY NO. 2016-00131 November 28, 2016 Page 3 of 9 The first floor of the remodeled building would include a brewery with a packing and shipping area, restaurant, bar, two kitchens, roaster area, tank bar, storage, offices and barrel room with a stage and VIP room. The barrel room would primarily be for storing and ageing beer, but on occasion would provide an area for private events. These private events would include weddings, music performances, and other planned gatherings. The maximum number of guests permitted for these events would not exceed 170 people to ensure compliance with the submitted parking demand study. Most of the second floor would be open to the area below. The second floor would be improved with a 1,000 square foot conference room for Golden Road Brewing corporate meetings. The outdoor dining, entertainment and recreation area would include food service, three outdoor bars, bocce ball court, gaming area, hammock grove, kid-safe play area, dog run, community and semi-private outdoor dining, swings, fire pits, projector screen and a platform stage for outdoor events. Rendering (Outdoor Dining and Recreation) A 580 square foot, detached retail space would be constructed at the northwest corner of the building. The retail building would be staffed during business hours, selling branded merchandise and retail-packaged beer in cans and bottles. Beer sales in the retail shop would be suspended before and during events at Angels Stadium, as recommended by the Police Department. As shown in the image below, the retail shop would be designed to resemble a silo with integrated signage, fencing, bike parking, hardscape features and layered landscaping. This building and adjacent outdoor space were designed to provide an architectural element near the corner of Dupont Drive and Orangewood Avenue and to create a connection to the public right- of-way that would encourage biking and walking to the facility. CONDITIONAL USE PERMIT NO. 2016-05860, CONDITIONAL USE PERMIT NO. 2016-05890, VARIANCE NO. 2016-05066 AND DETERMINATION OF PUBLIC CONVENIENCE OR NECESSITY NO. 2016-00131 November 28, 2016 Page 4 of 9 Rendering (Northwest Building Elevation and Retail Shop) The applicant is requesting hours of operation from 7:00 a.m. to 2:00 a.m., daily. A full service menu would be available at all times. During peak operational hours, an estimated thirty-one employees would be onsite. This would include three bartenders, one site manager, one operations manager, one restaurant manager, ten servers, seven food preparation workers, one general worker, one brew master, five brewers, and one security officer. The above improvements and operations, including the sale of alcohol for on and off-site premises sale and consumption, require approval of a conditional use permit and determination of public convenience or necessity. In addition, as part of the conditional use permit, the applicant is requesting approval of a coordinated sign program, which would include one monument sign, four wall signs and three directional signs. Several of these wall signs are illustrated in the renderings above. The sign program is summarized in the following table and a detailed sign exhibit is provided as Attachment No. 9 to this report. Sign # Type Height Width Square Footage 1 Monument 4 ft. 42 ft. 168 2 Wall 7 ft. 35 ft. 245 3 Directional 2.5 ft. 13 ft. 32.5 4 Deleted N/A N/A N/A 5 Wall 2.5 ft. 10 ft. 25 6 Directional 3 ft. 12 ft. 36 7 Directional 3.6 ft. 1.6 feet 6 8 Wall 6 ft. 43 ft. 258 9 Wall 6.25 ft. 8.75 ft. 55 CONDITIONAL USE PERMIT NO. 2016-05860, CONDITIONAL USE PERMIT NO. 2016-05890, VARIANCE NO. 2016-05066 AND DETERMINATION OF PUBLIC CONVENIENCE OR NECESSITY NO. 2016-00131 November 28, 2016 Page 5 of 9 A total of 320 parking spaces are required for the project and 239 spaces are proposed. A total of 75 parking spaces would be provided on-site. An additional 164 parking spaces would be provided directly across Dupont Drive, on Parcel B. The parking on Parcel B would be provided in the existing parking lot and within an industrial building. The indoor spaces would be available to patrons at all times, but would be reserved by security and valet services on the days that special events would be held at the facility. No physical modifications are being made to the off-site parking location. Because all Code required parking would not be provided on or off-site, the applicant is requesting a parking variance for Parcel A and a conditional use permit for off- site parking for Parcel B. FINDINGS AND ANALYSIS: Conditional Use Permit and Determination of Public Convenience or Necessity: Before the Planning Commission may approve a conditional use permit, it must make a finding of fact that the evidence presented shows that all of the following conditions exist: 1) That the proposed use is properly one for which a conditional use permit is authorized by this Zoning Code; 2) That the proposed use will not adversely affect the adjoining land uses, or the growth and development of the area in which it is proposed to be located; 3) That the size and shape of the site proposed for the use is adequate to allow the full development of the proposed use, in a manner not detrimental to either the particular area or health and safety; 4) That the traffic generated by the proposed use will not impose an undue burden upon the streets and highways designed and improved to carry the traffic in the area; and 5) That the granting of the conditional use permit under the conditions imposed, if any, will not be detrimental to the health and safety of the citizens of the City of Anaheim. The Zoning Code requires a conditional use permit in this zone to authorize the brew pub, the event space and outdoor recreation in order to ensure compatibility with surrounding uses. Recent amendments to the Zoning Code permit breweries with accessory tasting rooms without the need for a CUP in most commercial and industrial zones in the City; however; a CUP is required in this case based on the combination of the uses proposed. The applicant is requesting approval of on and off-premises sales and consumption of alcoholic beverages. A Type 1 (Beer Manufacturing) license, which authorizes a brewery with a restaurant, would be required from the California Department of Alcoholic Beverage Control (ABC). The Zoning Code requires a conditional use permit in this zone to authorize the sale of alcoholic beverages in order to ensure compatibility with surrounding uses. CONDITIONAL USE PERMIT NO. 2016-05860, CONDITIONAL USE PERMIT NO. 2016-05890, VARIANCE NO. 2016-05066 AND DETERMINATION OF PUBLIC CONVENIENCE OR NECESSITY NO. 2016-00131 November 28, 2016 Page 6 of 9 The location is within Police Reporting District No. 2228, which has a crime rate that is below the citywide average. There have been 11 calls for service to this location in the last year. The calls include two disturbances, seven security alarm responses, one abandoned vehicle and one drunk in public. The crime rate within ¼ mile of this property is 63 percent below the citywide average. Staff does not anticipate that the addition of alcoholic beverage sales at this location would contribute to an increase in crime if the business is operated in a responsible manner and in compliance with the recommended conditions of approval. These conditions include typical Police Department conditions for similar uses, such as requiring a security plan; requiring ABC LEAD (Licensee Education on Alcohol and Drugs) training for employees; and limiting the display area of alcoholic beverages, among others. The proposed restaurant and brew pub is consistent with the goals and objectives of the General Plan by contributing to vitality of the Platinum Triangle as “a thriving economic center that provides residents, visitors and employees with a variety of housing, employment, shopping and entertainment opportunities.” The addition of the outdoor dining and recreation area would bring the property into greater conformance with the Platinum Triangle Master Land Use Plan (PTMLUP) by creating an activated street frontage that will contribute to the vibrant, walkable urban environment envisioned for the Platinum Triangle. Outdoor noise would be limited since amplified music would require approval of a Special Event Permit. Based on these factors, staff believes that the proposed use would be compatible with the surrounding area and recommends approval of the conditional use permit. Coordinated Sign Program: Before the Planning Commission may approve a conditional use permit for a coordinated sign program, it must make a finding of fact that the evidence presented shows that all of the following conditions exist: 1) Signs shall complement the architecture of the buildings on the same property and provide a unifying element along the streetscape; and 2) The size, scale and style of signs shall be internally consistent and consistent with the scale of the buildings located on the same property and the surrounding land uses. The Code requires a conditional use permit for any coordinated sign program in the Platinum Triangle that does not meet the City’s sign code requirements, subject to the findings above. The proposed signs complement the architecture of the brew pub and retail can shop buildings. The signs are designed with high quality materials and a contemporary style and with the same exterior colors and finishes and would provide a unifying element along the streetscape. The size of the signs is consistent with the scale of the building. The implementation of a coordinated sign program would provide project identification, improved visibility and cohesive design elements. Therefore, staff recommends approval of this request. CONDITIONAL USE PERMIT NO. 2016-05860, CONDITIONAL USE PERMIT NO. 2016-05890, VARIANCE NO. 2016-05066 AND DETERMINATION OF PUBLIC CONVENIENCE OR NECESSITY NO. 2016-00131 November 28, 2016 Page 7 of 9 Parking Variance: A variance shall be granted upon a finding by the Planning Commission or City Council that the evidence presented shows that all of the following conditions exist: 1) That the variance, under the conditions imposed, if any, will not cause fewer off-street parking spaces to be provided for the proposed use than the number of such spaces necessary to accommodate all vehicles attributable to such use under the normal and reasonably foreseeable conditions of operation of such use; 2) That the variance, under the conditions imposed, if any, will not increase the demand and competition for parking spaces upon the public streets in the immediate vicinity of the proposed use; 3) That the variance, under the conditions imposed, if any, will not increase the demand and competition for parking spaces upon adjacent private property in the immediate vicinity of the proposed use; 4) That the variance, under the conditions imposed, if any, will not increase traffic congestion within the off-street parking areas or lots provided for the proposed use; and 5) That the variance, under the conditions imposed, if any, will not impede vehicular ingress to or egress from adjacent properties upon the public streets in the immediate vicinity of the proposed use. The Zoning Code requires that parking demand be calculated by combining all of the proposed uses for the entire project. A total of 320 parking spaces are required for the proposed project as shown in the table below. The applicant is proposing to provide a total of 239 parking spaces, of which 75 parking spaces would be provided on-site and an additional 164 parking spaces would be provided off-site, directly across Dupont Drive on Parcel B. CONDITIONAL USE PERMIT NO. 2016-05860, CONDITIONAL USE PERMIT NO. 2016-05890, VARIANCE NO. 2016-05066 AND DETERMINATION OF PUBLIC CONVENIENCE OR NECESSITY NO. 2016-00131 November 28, 2016 Page 8 of 9 Code Required Parking Use Code Requirement Proposed Floor Area (s.f.) Spaces Required Alcoholic Beverage Manufacturing 1.55 spaces/1,000 s.f. May include 10 percent office space 14,484 23 Alcoholic Beverage Tasting Room 17 spaces/1,000 s.f. 770 13 Entertainment Venue 17 spaces/1,000 s.f. 3,378 57 Outdoor Recreation Requires Parking Demand Study 8,517 20 Full Service Restaurant 15 spaces/1,000 s.f. 7,054 106 Outdoor Dining- Restaurant 15 spaces/1,000 s.f. 1,942 29 Outdoor Seating- Fast/Casual 15 spaces/1,000 s.f. 4,147 62 Retail 5.5 spaces/1,000 s.f. 580 3 TOTAL 320 A parking study prepared by LSA Associates, Inc., dated October, 2016, was submitted in order to analyze the project parking demand. The study identified several factors that would contribute to a parking demand less than required by Code. For example, Golden Road Brewing’s main manufacturing facility is located in the City of Los Angeles and this new location would specialize in lower batches of experimental beer, which requires a significant amount of space for storage, aging and fermenting. The Code requires 23 spaces for the brewing area, but there would only be eight employees on site for brewing operations. In addition, the outdoor recreational space and seating would function differently than typical outdoor dining for a full- service restaurant. All customers would walk up to a counter for food and beverages, therefore requiring less staff. Due to the unique nature of the outdoor area, the density of seating is much less than a typical outdoor dining area. The study also provides consideration for alternative modes of travel. Since the project is located within the Platinum Triangle, it is within walking distance to several planned and constructed residential developments. As a condition of approval, the applicant will be required to financially participate in the Anaheim Transportation Network, which operates the ART (Anaheim Resort Transit) busses. As a result, there may be the opportunity for Golden Road patrons to access the brewery using ART. The project is also CONDITIONAL USE PERMIT NO. 2016-05860, CONDITIONAL USE PERMIT NO. 2016-05890, VARIANCE NO. 2016-05066 AND DETERMINATION OF PUBLIC CONVENIENCE OR NECESSITY NO. 2016-00131 November 28, 2016 Page 9 of 9 designed to provide a convenient drop off and pick-up location near the main entrance which would accommodate taxis and smartphone based ridesharing. Based on these factors, the study concluded that the actual parking demand would be 237 spaces. Staff believes that the number of parking spaces proposed on and off-site would be adequate to accommodate the proposed brew pub without impact to the surrounding public streets or properties. A safe path of travel for patrons to connect to the off-site parking would be provided by a future signalized crosswalk on Dupont Drive. Staff is recommending conditions of approval to ensure the successful management of the off-site parking such as the requirement for valet service during events, security to help direct traffic, adequate lighting and directional signs. Environmental Impact Analysis: The project’s potential environmental impacts have been evaluated and staff recommends that the Planning Commission determine that the development qualifies for a Class 32 “Infill Development Projects” exemption allowed under California Environmental Quality Act. In order to support this determination, staff prepared an environmental checklist and determined that the project would not result in any significant effects relating to traffic, noise, air quality, or water quality. In reaching this conclusion, staff determined that the subject property is less than five acres in size and surrounded by urban uses; has no value as habitat for endangered, rare or threatened species; and, can be adequately served by all required utilities and public services. Based on these findings, the project does not meet the minimum thresholds that would suggest the potential for the project to cause a significant effect on the environment. CONCLUSION: The proposed brew pub with events and outdoor entertainment would complement existing nearby businesses and entertainment venues and would bring the property into greater conformance with the PTMLUP. The recommended conditions of approval would ensure that the sale and consumption of alcoholic beverages would be compatible with surrounding land uses. In addition, an adequate supply of parking would be provided to serve the proposed use. Staff recommends approval of this request. Prepared by, Submitted by, Amy Vazquez Jonathan E. Borrego Contract Planner, Lilley Planning Group Planning Services Manager Attachments: 1. Draft Conditional Use Permit and Variance Resolution (Parcel A) 2. Draft Determination of Public Convenience or Necessity Resolution (Parcel A) 3. Draft Conditional Use Permit Resolution (Parcel B) 4. Letter of Request 5. Parking Study 6. Trip Generation Memorandum 7. Police Memorandum 8. Complete Plan Set 9. Coordinated Sign Program 10. Renderings 11. Class 32 Environmental Checklist I (PTMU)OrangewoodINDUSTRIALI (PTMU)Gateway Sub-Area BGATEWAY APARTMENT I (PTMU)Gateway Sub-Area BARCHSTONEAPARTMENTS I (PTMU)GatewaySub-Area CVACANT I (PTMU)OrangewoodINDUSTRIAL I (PTMU)OrangewoodINDUSTRIAL I (PTMU)OrangewoodINDUSTRIAL I (PTMU)OrangewoodINDUSTRIAL PR (PTMU)StadiumANGEL STADIUMOF ANAHEIM I (PTMU)Gateway Sub-Area CVACANT I (PTMU)Gateway Sub-Area CVACANT I (PTMU)OrangewoodINDUSTRIAL I (PTMU)OrangewoodINDUSTRIAL I (PTMU)OrangewoodINDUSTRIAL O-L (PTMU)OrangewoodOFFICES I (PTMU)GatewaySub-Area CVACANT E ORANGEWOOD AVE S D U P O N T D R D U P O N T D R E. KATELLA AVE S . H A S T E R S T E. ORANGEWOOD AVE E. CHAPMAN AVE E. GENE AUTRY WAY S .D O U G L A S S R DE. HOWELL AVE 2210 and 2220 East Orangewood Avenue DEV No. 2016-00015 Subject Property APN: 083-271-13083-272-01 °0 50 100 Feet Aerial Photo:June 2015 Parcel AParcel B E ORANGEWOOD AVE S D U P O N T D R D U P O N T D R E. KATELLA AVE S . H A S T E R S T E. ORANGEWOOD AVE E. CHAPMAN AVE E. GENE AUTRY WAY S .D O U G L A S S R DE. HOWELL AVE 2210 and 2220 East Orangewood Avenue DEV No. 2016-00015 Subject Property APN: 083-271-13083-272-01 °0 50 100 Feet Aerial Photo:June 2015 Parcel AParcel B [DRAFT] ATTACHMENT NO. 1 - 1 - PC2016-*** RESOLUTION NO. PC2016-*** A RESOLUTION OF THE PLANNING COMMISSION OF THE CITY OF ANAHEIM APPROVING CONDITIONAL USE PERMIT NO. 2016-05860 AND VARIANCE NO. 2016-05066 AND MAKING CERTAIN FINDINGS IN CONNECTION THEREWITH (DEV2016-00015) (2210 AND 2220 EAST ORANGEWOOD AVENUE) WHEREAS, the Planning Commission of the City of Anaheim ("Planning Commission") did receive a verified petition to approve (i) Conditional Use Permit No. 2016-05860 to conditionally permit the construction and operation of a brew pub within an industrial building, including (a) an event space and an outdoor dining and recreational/entertainment area, (b) the on- and off-premises sale and consumption of alcoholic beverages, and (c) a coordinated sign program; (ii) Variance No. 2016-05066 to permit fewer parking spaces than required by the Zoning Code at 2210 and 2220 East Orangewood Avenue in the City of Anaheim (the Property"),; and (iii) Conditional Use Permit No. 2016-05890 to conditionally permit to allow off-site parking for a brew pub with an outdoor dining and recreation area on that certain real property located adjacent to the Property at 2130 East Orangewood Avenue East Orangewood Avenue. The Property is generally depicted on the map attached hereto as Exhibit A and incorporated herein by this reference; and WHEREAS, the Property, consisting of approximately 2.5 acres, is developed with an industrial building. The Land Use Element of the Anaheim General Plan designates the Property for “M-U” Mixed Use land uses. The Property is located in both the “I” Industrial Zone and the Platinum Triangle Mixed Use (PTMU) Overlay Zone. Generally, the development standards and regulations of Chapter 18.20 (Platinum Triangle Mixed Use (PTMU) Overlay Zone) of the Anaheim Municipal Code (the "Code") supersede the regulations of the underlying zone, i.e., that of the “I” Industrial Zone. However, the provisions of Chapter 18.20 (Platinum Triangle Mixed Use (PTMU) Overlay Zone) do not apply to parcels that have been, or are proposed to be, developed entirely under the “I” Industrial Zone, which is the case with the Proposed Project; and WHEREAS, Conditional Use Permit No. 2016-05860 and Variance No. 2016-05066 are proposed in conjunction with a request for a determination of "Public Convenience or Necessity" to conditionally permit the sale of alcoholic beverages for on- and off-premises consumption in conjunction with a brew pub at the Property, which request is designated as "Public Convenience or Necessity No. 2016-00131". Conditional Use Permit No. 2016-05860, Variance No. 2016-05066, Public Convenience or Necessity No. 2016-00131 and Conditional Use Permit No. 2016-05890 shall be referred to herein collectively as the “Proposed Project”; and WHEREAS, the Planning Commission did hold a public hearing at the Civic Center in the City of Anaheim on November 28, 2016 at 5:00 p.m., notice of said public hearing having been duly given as required by law and in accordance with the provisions of Chapter 18.60 (Procedures) of the Code, to hear and consider evidence for and against the Proposed Project and to investigate and make findings and recommendations in connection therewith; and - 2 - PC2016-*** WHEREAS, pursuant to and in accordance with the provisions of the California Environmental Quality Act (Public Resources Code Section 21000 et seq.; herein referred to as “CEQA”), the State of California Guidelines for Implementation of the California Environmental Quality Act (Title 14 of the California Code of Regulations; herein referred to as the "CEQA Guidelines"), and the City's Local CEQA Procedure Manual, the City is the "lead agency" for the preparation and consideration of environmental documents for the Proposed Project; and WHEREAS, this Planning Commission finds and determines that the Proposed Project is within that class of projects (i.e., Class 32 – In-fill Development Projects) which consists of in- fill development meeting the conditions described in Section 15332 of the CEQA Guidelines. Specifically, the Proposed Project (a) is consistent with the applicable General Plan designation and all applicable General Plan policies and is consistent with the applicable zoning designation and regulations, (b) is no more than five acres in size substantially surrounded by urban uses, (c) has no value as a habitat for endangered, rare or threatened species, (d) would not result in significant effects relating to traffic, noise, air quality, or water quality, and (e) the Property can be adequately served by all required utilities and public services. Accordingly, pursuant to Section 15332 of the CEQA Guidelines, this Planning Commission finds and determines that the Proposed Project will not cause a significant effect on the environment and is, therefore, categorically exempt from the provisions of CEQA; and WHEREAS, the Planning Commission, after due inspection, investigation and study made by itself and in its behalf, and after due consideration of all evidence and reports offered at said hearing pertaining to the request for Conditional Use Permit No. 2016-05860, does find and determine the following facts: 1. The proposed request to permit a brew pub to include an event space and an outdoor dining and recreational/entertainment area with the on- and off-premises sale and consumption of alcoholic beverages and a coordinated sign program areallowable uses within the "I" Industrial Zone under Section 18.10.030 (Uses) of Chapter 18.10 (Industrial Zone) of the Code, subject to a conditional use permit and the zoning and development standards of the "I" Industrial Zone. 2. The the uses proposed under Conditional Use Permit No. 2016-05860, under the conditions imposed, are compatible with the existing industrial uses in the surrounding area. 3. The size and shape of the site for the uses proposed under Conditional Use Permit No. 2016-05860 are, under the conditions imposed, adequate to allow the full development of the proposed uses in a manner not detrimental to the particular area or to the health and safety because the facilities on the Property will adhere to all required land use standards. 4. The traffic generated by the uses proposed under Conditional Use Permit No. 2016- 05860, under the conditions imposed, will not impose an undue burden upon the streets and highways designed and improved to carry the traffic in the area because the traffic generated by this use will not exceed the anticipated volumes of traffic on the surrounding streets. 5. The granting of Conditional Use Permit No. 2016-05860, under the conditions imposed, will not be detrimental to the health and safety of the citizens of the City of Anaheim as the proposed project will be compatible with the surrounding area through conditions of approval for the use and is not a health or safety risk to the citizens of the City of Anaheim. - 3 - PC2016-*** 6. The uses proposed under Conditional Use Permit No. 2016-05860 will bring the Property into greater conformity with the intent of the Platinum Triangle Master Land Use Plan. WHEREAS, based upon the parking study submitted by the applicant and observations made by staff, the Planning Commission does further find and determine that the request for Variance No. 2016-05066 for less parking than required by the Code should be approved for the following reasons: SECTION NO. 18.42.040 Minimum number of parking spaces. (320 spaces required; 239 spaces proposed) 1. The variance for the Property, under the conditions imposed, will not cause fewer off-street parking spaces to be provided for the Property, including the proposed restaurant and brewery, than the number of such spaces necessary to accommodate all vehicles attributable to all uses at the Property under the normal and reasonably foreseeable conditions of operation of such uses. A parking study prepared by LSA Associates, Inc., dated October, 2016, was submitted in order to analyze the project parking demand. The study identified several factors that would contribute to a parking demand less than required by Code. Such factors include a significant amount of space will be used for storage, aging and fermenting in the facility and there will be only be eight employees on site for brewing operations. Since the project is located within the Platinum Triangle, it is within walking distance to several planned and constructed residential developments. The project is also designed to provide a convenient drop off and pick-up location near the main entrance which would accommodate taxis and smartphone based ridesharing. Based on these factors, the study concluded that the actual maximum parking demand would be 237 spaces; 2. The variance for the Property, under the conditions imposed, will not increase the demand and competition for parking spaces upon the public streets in the immediate vicinity of the proposed use because the on-site parking will adequately accommodate the peak parking demands of all combined uses on the site; 3. The variance for the Property, under the conditions imposed, will not increase the demand and competition for parking spaces upon adjacent private property in the immediate vicinity of the Property because the on- and off-site parking will adequately accommodate peak parking demands of all uses on the site; 4. The variance for the Property, under the conditions imposed, will not increase traffic congestion within the off-street parking areas or lots provided for the Property because the Property provides adequate ingress and egress points, which are designed to allow for adequate on-site circulation; and 5. The variance for the Property, under the conditions imposed, will not impede vehicular ingress to or egress from adjacent properties upon the public streets in the immediate vicinity of the Property because the Property has existing ingress or egress access points that are designed to allow adequate on-site circulation and, therefore, will not impede vehicular ingress to or egress from adjacent properties upon the public streets in the immediate vicinity of the Property. - 4 - PC2016-*** WHEREAS, the Planning Commission determines that the evidence in the record constitutes substantial evidence to support the actions taken and the findings made in this Resolution, that the facts stated in this Resolution are supported by substantial evidence in the record, including testimony received at the public hearing, the staff presentations, the staff report and all materials in the project files. There is no substantial evidence, nor are there other facts, that detract from the findings made in this Resolution. The Planning Commission expressly declares that it considered all evidence presented and reached these findings after due consideration of all evidence presented to it. NOW, THEREFORE, BE IT RESOLVED that the Planning Commission does hereby approve Conditional Use Permit No. 2016-05860 and Variance No. 2016-05066, contingent upon and subject to (i) approval of Public Convenience or Necessity No. 2016-00131 and Conditional Use Permit No. 2016-05890, now pending, and (ii) the conditions of approval set forth in Exhibit B attached hereto and incorporated herein by this reference, which are hereby found to be a necessary prerequisite to the proposed use of the Property under Conditional Use Permit No. 2016-05860 and Variance No. 2016-05066 in order to preserve the health, safety and general welfare of the citizens of the City of Anaheim. Extensions for further time to complete conditions of approval may be granted in accordance with Section 18.60.170 of the Code. Timing for compliance with conditions of approval may be amended by the Planning Director upon a showing of good cause provided (i) equivalent timing is established that satisfies the original intent and purpose of the condition, (ii) the modification complies with the Code, and (iii) the applicant has demonstrated significant progress toward establishment of the use or approved development. BE IT FURTHER RESOLVED that any amendment, modification or revocation of this permit may be processed in accordance with Chapters 18.60.190 (Amendment to Permit Approval) and 18.60.200 (City-Initiated Revocation or Modification of Permits) of the Code. BE IT FURTHER RESOLVED that the Planning Commission does hereby find and determine that adoption of this Resolution is expressly predicated upon applicant's compliance with each and all of the conditions hereinabove set forth. Should any such condition, or any part thereof, be declared invalid or unenforceable by the final judgment of any court of competent jurisdiction, then this Resolution, and any approvals herein contained, shall be deemed null and void. BE IT FURTHER RESOLVED that approval of this application constitutes approval of the proposed request only to the extent that it complies with the Code and any other applicable City, State and Federal regulations. Approval does not include any action or findings as to compliance or approval of the request regarding any other applicable ordinance, regulation or requirement. - 5 - PC2016-*** THE FOREGOING RESOLUTION was adopted at the Planning Commission meeting of November 28, 2016. Said resolution is subject to the appeal provisions set forth in Chapter 18.60 (Procedures) of the Anaheim Municipal Code pertaining to appeal procedures and may be replaced by a City Council Resolution in the event of an appeal. CHAIRPERSON, PLANNING COMMISSION OF THE CITY OF ANAHEIM ATTEST: SECRETARY, PLANNING COMMISSION OF THE CITY OF ANAHEIM STATE OF CALIFORNIA ) COUNTY OF ORANGE ) ss. CITY OF ANAHEIM ) I, Eleanor Morris, Secretary of the Planning Commission of the City of Anaheim, do hereby certify that the foregoing resolution was passed and adopted at a meeting of the Planning Commission of the City of Anaheim held on November 28, 2016, by the following vote of the members thereof: AYES: COMMISSIONERS: NOES: COMMISSIONERS: ABSENT: COMMISSIONERS: IN WITNESS WHEREOF, I have hereunto set my hand this 28th day of November, 2016. SECRETARY, PLANNING COMMISSION OF THE CITY OF ANAHEIM - 6 - PC2016-*** - 7 - PC2016-*** EXHIBIT “B” CONDITIONAL USE PERMIT NO. 2016-05860 AND VARIANCE NO. 2016-05066 (DEV2016-00015) NO. CONDITIONS OF APPROVAL RESPONSIBLE DEPARTMENT PRIOR TO THE ISSUANCE OF GRADING PERMITS 1 The applicant shall submit to the Public Works Department, Development Services, for review and approval, a Water Quality Management Plan, as described in Drainage Area Management Plan for Orange County. Said WQMP shall:  Address Site Design Best Management Practices (BMPs) such as minimizing impervious areas, maximizing permeability, minimizing directly connected impervious areas, creating reduced or “zero discharge” areas, and conserving natural areas.  Incorporate applicable Routine Source Control BMPs.  Incorporate Treatment Control BMPs.  Describe the long-term operation and maintenance, identifies the responsible parties, and funding mechanisms for the Treatment Control BMPs. Public Works, Development Services 2 Prior to issuance of the grading permit and right-of-way construction permit for the storm drain, a Save Harmless agreement in-lieu of an Encroachment Agreement for any storm drains connecting to a City storm drain is required to be executed by the property owner, approved by the City and recorded in the Office of the Orange County Recorder. Public Works, Development Services 3 Prior to grading plan approval, the applicant shall submit a Drainage Study prepared by a registered professional Civil Engineer in the State of California. The Study shall be based upon and reference the latest edition of the Orange County Hydrology Manual the applicable City of Anaheim Master Plan of Drainage for the project area. All drainage sub-area boundaries per the Master Plan for Drainage shall be maintained. The Study shall include: an analysis of 10-, 25- and 100- year storm frequencies; an analysis of all drainage impacts to the existing storm drain system based upon the ultimate project build-out condition; and address whether off-site and/ or on-site drainage improvements (such as detention/ retention basins or surface runoff reduction) will be required to prevent downstream properties from becoming flooded. Public Works, Development Services 4 The Owner shall demonstrate that coverage has been obtained under California’s General Permit for Stormwater Discharges associated Public Works, Development Services - 8 - PC2016-*** NO. CONDITIONS OF APPROVAL RESPONSIBLE DEPARTMENT with Construction Activity by providing a copy of the Notice of Intent (NOI) submitted to the State Water Resources Control Board and a copy of the subsequent notification of the issuance of a Waste Discharge Identification (WDID) number. PRIOR TO ISSUANCE OF BUILDING PERMITS 5 The building shall be equipped with an alarm system (silent or audible). Police Department 6 Complete a Burglary/Robbery Alarm Permit application, Form APD 516, and return it to the Police Department prior to initial alarm activation. This form is available at the Police Department front counter, or it can be downloaded from the following web site: http://www.anaheim.net/article.asp?id=678 Police Department 7 All exterior doors to have adequate security hardware, e.g. deadbolt locks. Police Department 8 The developer shall submit street improvement plans to the Public Works Department to construct sidewalk adjacent to the ultimate right of way line along frontage of the property on Orangewood Ave and Dupont, , install landscape and irrigation between the sidewalk and existing curb on Orangewood Avenue in conformance with Platinum Triangle Implementation plan and remove and replace the accessible pedestrian ramp. Parkway landscaping shall be irrigated from an onsite point of connection. The improvements shall be constructed prior to final building and zoning inspection. Public Works, Development Services 9 A bond securing the completion of the public improvements shall be posted in an amount approved by the City Attorney. Public Works, Development Services 10 The legal property owner shall dedicate to City of Anaheim an easement of 2.5 feet in width behind the ultimate property line in Orangewood Avenue for sidewalk purposes. Public Works, Development Services PRIOR TO FINAL BUILDING AND ZONING INSPECTIONS 11 All required public right of way improvements shall be completed, operational, and are subject to review and approval by the Construction Services Inspector. Public Works, Development Services 12 Applicant must demonstrate that all structural BMP’s described in the Project WQMP have been constructed and installed in conformance with approved plans and specifications. Public Works, Development Services - 9 - PC2016-*** NO. CONDITIONS OF APPROVAL RESPONSIBLE DEPARTMENT 13 The property owner shall join and financially participate in a clean fuel shuttle program such as the Anaheim Resort Transit system, and shall participate in the Anaheim Transportation Network in conjunction with the on-going operation of the project. The property owner shall also record a covenant on the property that requires participation in these programs ongoing during project operation. The form of the covenant shall be approved by the City Attorney’s Office prior to recordation. Planning and Building Department, Planning Services 14 The property owner shall request termination of Conditional Use Permit No. 2015-05811 for the temporary tasting room since this permit would no longer be necessary. Planning and Building Department, Planning Services Division OPERATIONAL CONDITIONS 15 That subject alcoholic beverage license shall not be exchanged for a public premise (bar) type license nor shall the establishment be operated as a public premise as defined in Section 23039 of the Business and Professions Code. Police Department 16 At all times when the premise is open for business, the premise shall be maintained as a bona fide restaurant and shall provide a menu containing an assortment of foods normally offered in such restaurant. Police Department 17 Any and all security officers provided shall comply with all State and Local ordinances regulating their services, including, without limitation, Chapter 11.5 of Division 3 of the California Business and Profession Code. (Section 4.16.070 Anaheim Municipal Code) Police Department 18 Petitioner shall not share any profits, or pay any percentage or commission to a promoter or any other person, based upon monies collected as a door charge, cover charge, or any other form of admission charge, including minimum drink orders, or the sale of drinks. Police Department 19 The Can/Outside Retail Shop shall be closed two hours prior to events Angel Stadium and remain closed while the event takes place. It may re-open when the event has concluded. Police Department 20 The patio must be fenced and fully enclosed. If there is a pedestrian gate it must be self-closing and have a sign posted on the interior that reads “No alcohol beyond this point.” Police Department - 10 - PC2016-*** NO. CONDITIONS OF APPROVAL RESPONSIBLE DEPARTMENT 21 Parking lots, driveways, circulation areas, aisles, passageways, recesses and grounds contiguous to buildings, shall be provided with enough lighting to illuminate and make clearly visible the presence of any person on or about the premises during the hours of darkness and provide a safe, secure environment for all persons, property, and vehicles onsite. Police Department 22 Security measures shall be provided to the satisfaction of the Anaheim Polices Department and to prevent disturbances to the neighborhood by excessive noise created by patrons entering or leaving the premises. Police Department 23 Music in the outdoor space must be acoustic in nature with no amplification unless a Special Event Permit is granted. A maximum of twelve (12) Special Event Permits shall be permitted per year. Outdoor activities that include alcoholic beverage consumption are subject to review and approval by all applicable City departments. All accessory permits shall be obtained as deemed necessary. The outdoor events shall provide adequate security as required by the Police Department. Police Department and Planning Department, Planning Services Division 24 All entertainment in the outdoor space (music, movies, poetry readings, etc.) shall conclude by 12:00 a.m. Sunday thru Thursday, and 2:00 a.m. Friday and Saturday. Police Department 25 A security plan must be submitted to the Chief of Police or his designee for approval prior to the restaurant opening for business. Areas to be covered/discussed would be:  indoor event/concert/VIP area  game day rivals  eviction of over intoxicated individuals  regular business operations including the outdoor patio area. Police Department 26 Managers/Owners need to call the Department of Alcoholic Beverage control and obtain LEAD (Licensee Education on Alcohol and Drugs Program) Training for themselves and service employees. The number is 714-558-4101. Police Department 27 Any Graffiti painted or marked upon the premises or on any adjacent area under the control of the licensee shall be removed or painted over within 24 hours of being applied. Police Department 28 The petitioner shall be responsible for maintaining free of litter the area adjacent to the premises over which they have control, as depicted. Police Department - 11 - PC2016-*** NO. CONDITIONS OF APPROVAL RESPONSIBLE DEPARTMENT 29 The number of persons occupying the premises shall not exceed the maximum occupancy load as determined by the Anaheim Fire Department. Signs indicating the occupant load shall be posted in a conspicuous place on an approved sign near the main exit from the room. (Section 25.114(a) Uniform Fire Code). Police Department 30 The door(s) shall be kept closed at all times during the operation of the business premises except in cases of emergency. Said door(s) shall not consist of a screen or ventilated security door. Police Department 31 The permitted event or activity shall not create sound levels which violate any ordinance of the City of Anaheim. Police Department 32 Any violation of the application, or any attached conditions, shall be sufficient grounds to revoke the permit. Police Department 33 Petitioner(s) shall police the area under their control in an effort to prevent the loitering of persons about the business premises. Police Department 34 No required parking area shall be fenced-off or otherwise enclosed for outdoor storage uses. Planning and Building Department, Code Enforcement Division 35 The restaurant and brewery shall be operated in accordance with the Statement of Operations submitted as part of this application. Any changes to the business operation as described in that document shall be subject to review and approval by the Planning Director to determine substantial conformance with the Letter of Request and to ensure compatibility with the surrounding uses. Planning and Building Department, Planning Services Division 36 The off-site parking shall be limited to the patrons and employees of Golden Road Brewing. An executed agreement to provide off-site parking on the property to the west, as described in the parking study, in a form satisfactory to the City Attorney, shall be submitted to the Planning Services Division. Said agreement shall remain in full force and effect at all times. In addition, the parking shall not be used for Angel Stadium event parking at any time. Planning and Building Department, Planning Services Division 37 The indoor events shall be limited to 170 guests. Valet parking shall be provided any time an event takes place. Planning and Building Department, Planning Services Division - 12 - PC2016-*** NO. CONDITIONS OF APPROVAL RESPONSIBLE DEPARTMENT 38 A valet parking operator shall be employed on days when special events are scheduled to occur in the evening or when lunchtime event attendance will exceed 50 guests. On days when valet service will be utilized, access to the building at 2130 East Orangewood Avenue shall be controlled from the beginning of the operating day. Valet attendants shall begin serving customers by noon or one hour before the start of the event, whichever is earlier. Planning and Building Department, Planning Services Division 39 Adequate lighting of parking lots, driveway, circulation areas, aisles, passageways, recesses and grounds contiguous to buildings shall be provided with lighting of sufficient wattage to provide adequate illumination to make clearly visible the presence of any person on or about the premises during the hours of darkness and provide a safe, secure environment for all persons, property, and vehicles on-site. Police Department 40 All truck maneuvers shall be performed on-site. Trucks shall not back in from or back up into Dupont Drive. Public Works, Traffic Engineering 41 That ongoing during project operations, no entrance to the proposed project shall be provided on the northeast corner of the project site, so as to prevent patrons from illegally jay-walking across Orangewood Avenue. The entrance shall be located on the northwest corner of the project site, adjacent to the intersection of Orangewood Avenue and Dupont Drive (west), so as to encourage patrons to utilize the crosswalk which will be provided at the proposed traffic signal at Orangewood Ave and Dupont Drive (west). Public Works, Traffic Engineering 42 If it is determined that patrons of the proposed project are illegally jay-walking across Orangewood Avenue, the applicant shall be required to meet with City staff to determine measures to mitigate the jay-walking, which may include but is not limited to installation of signage, installation of railing, installation of fencing on both private and public property, subject to City approval. Public Works, Traffic Engineering 43 The applicant shall be responsible for maintaining the area adjacent to the premises over which they have control, in an orderly fashion through the provision of regular maintenance and removal of trash or debris. Any graffiti painted or marked upon the premises or on any adjacent area under the control of the licensee shall be removed or painted over within 24 hours of being applied. Planning and Building Department, Code Enforcement Division - 13 - PC2016-*** NO. CONDITIONS OF APPROVAL RESPONSIBLE DEPARTMENT 44 The operation of this use is contingent upon the continued availability of a minimum of 239 parking spaces as recommended in the parking study prepared by LSA Associates, Inc., dated October, 2016. Any proposed modifications to the approved parking arrangement shall be subject to the review and approval of Planning Department. Planning and Building Department, Planning Services Division GENERAL CONDITIONS 45 The Applicant is responsible for paying all charges related to the processing of this discretionary case application within 30 days of the issuance of the final invoice or prior to the issuance of building permits for this project, whichever occurs first. Failure to pay all charges shall result in delays in the issuance of required permits or may result in the revocation of the approval of this application. Planning and Building Department, Planning Services Division 46 The Applicant shall defend, indemnify, and hold harmless the City and its officials, officers, employees and agents (collectively referred to individually and collectively as “Indemnitees”) from any and all claims, actions or proceedings brought against Indemnitees to attack, review, set aside, void, or annul the decision of the Indemnitees concerning this permit or any of the proceedings, acts or determinations taken, done, or made prior to the decision, or to determine the reasonableness, legality or validity of any condition attached thereto. The Applicant’s indemnification is intended to include, but not be limited to, damages, fees and/or costs awarded against or incurred by Indemnitees and costs of suit, claim or litigation, including without limitation attorneys’ fees and other costs, liabilities and expenses incurred by Indemnitees in connection with such proceeding. Planning and Building Department, Planning Services Division 47 The property shall be developed substantially in accordance with plans and specifications submitted to the City of Anaheim by the applicant and which plans are on file with the Planning Department and as conditioned herein. Planning and Building Department, Planning Services Division - 14 - PC2016-*** EXHIBIT “C” COORDINATED SIGN PROGRAM CONDITIONAL USE PERMIT NO. 2015-05860 (DEV2016-00015) B.O. Sign: ±13'-0" A.F.G. B.O. Sign: ±1'-6" A.F.G. 42'-0" 4' - 0 " 35'-0" 7 ' - 0 " 13'-0" 2' - 6 " 10'-0" 2' - 6 " SIGN SPECIFICATIONS: Dimensional colored backlit acrylic letters, sitting in front of perforated metal screen with branding graphic. LOCATION: North Elevation SIGN SPECIFICATIONS: Prefabricated prefinished flat cut letters LOCATION: West Elevation SIGN SPECIFICATIONS: Painted supergraphic on prefinished metal siding. LOCATION: West Elevation of Can Shop SIGN SPECIFICATIONS: Dimensional lettering on new illuminated wood panel / concrete monument sign. LOCATION: West/East Elevations B.O. Sign: ±5'-0" A.F.G. 3'-8" 1' - 8 " B.O. Sign: ±10'-4" A.F.G. 12'-0" 3' - 0 " B.O. Sign: ±7'-0" A.F.G. SIGN SPECIFICATIONS: Painted graphic on painted concrete. LOCATION: North Elevation SIGN SPECIFICATIONS: Painted graphic on painted concrete. LOCATION: West Elevation GOLDEN ROAD BREWING 2210 E. ORANGEWOOD AVE 1 B.O. Sign: ±2'-3" A.F.G. 1 2 2 3 3 9 5 6 7 7 6 5 8 43'-0" 6 ' - 0 " SIGN SPECIFICATIONS: Painted graphic on painted concrete. LOCATION: North Elevation B.O. Sign: ±12'-0" A.F.G. 8 9 8'-9" 6' - 3 " B.O. Sign: ±2'-6" A.F.G. SIGN SPECIFICATIONS: Painted graphic on prefinished metal siding. LOCATION: East Elevation of Can Shop 2 REV. 2 10/19/2016 EXHIBIT “C” COORDINATED SIGN PROGRAM CONDITIONAL USE PERMIT NO. 2015-05860 (DEV2016-00015) Date: Job No: Sheet No: A Drawing: Drawn By: Checked By: GOLDEN ROAD BREWING 2210 E. ORANGEWOOD AVE. ANAHEIM, CA 92806 16034 19-OCT-2016 - - SIGNAGE PLAN BUILDING ELEVATIONS S2 3/32" = 1'-0" ORANGEWOOD AVENUE ELEVATION - FOREGROUND 3/32" = 1'-0" ORANGEWOOD AVENUE MINOR ELEVATION 3/32" = 1'-0" DUPONT (EAST) ELEVATION 3/32" = 1'-0" ORANGEWOOD AVENUE ELEVATION 0'-0" (+148.25')T.O. (E) SLAB 20'-8" T.O. (E) PARAPET 0'-0" (+148.25')T.O. (E) SLAB 20'-8" T.O. (E) PARAPET 0'-0" (+148.25') T.O. (E) SLAB 20'-8"T.O. (E) PARAPET21'-4"T.O. (E) PARAPET CAN SHOP - OPTION 1 CAN SHOP - OPTION 1 2 REV. 2 10/19/2016 SITE LIN E PAINTED MURAL/ BANNER/ SUPERGRAPHICS 6 1 PAINTED WALL PATTERN ON EXISTING CONCRETE 1 8 9 NOTE: NUMBERS REFERENCE SIGN INDEX ON SHEET S1 EXHIBIT “C” COORDINATED SIGN PROGRAM CONDITIONAL USE PERMIT NO. 2015-05860 (DEV2016-00015) Date: Job No: Sheet No: A Drawing: Drawn By: Checked By: GOLDEN ROAD BREWING 2210 E. ORANGEWOOD AVE. ANAHEIM, CA 92806 16034 19-OCT-2016 - - SIGNAGE PLAN BUILDING ELEVATIONS S3 3/32" = 1'-0" SOUTH ELEVATION 3/32" = 1'-0" DUPONT (WEST) ELEVATION 0'-0" (+148.25')T.O. (E) SLAB 20'-0"T.O. (E) PARAPET 0'-0" (+148.25') T.O. (E) SLAB 20'-0"T.O. (E) PARAPET CAN SHOP - OPTION 1 CAN SHOP - OPTION 1 2 REV. 2 10/19/2016 SITE LINE EXISTING POWER LINE EXISTING POWER LINEEXISTING POWER LINE PAINTED MURAL/ BANNER/ SUPERGRAPHICS9 2 7 3 EXHIBIT “C” COORDINATED SIGN PROGRAM CONDITIONAL USE PERMIT NO. 2015-05860 (DEV2016-00015) [DRAFT] ATTACHMENT NO. 2 - 1 - PC2016-*** RESOLUTION NO. PC2016-*** A RESOLUTION OF THE PLANNING COMMISSION OF THE CITY OF ANAHEIM DETERMINING PUBLIC CONVENIENCE OR NECESSITY NO. 2016-00131 TO PERMIT A TYPE 1 (BEER MANUFACTURER) ALCOHOLIC BEVERAGE CONTROL LICENSE AND MAKING CERTAIN FINDINGS IN CONNECTION THEREWITH (DEV2016-00015) (2210 AND 2220 EAST ORANGEWOOD AVENUE) WHEREAS, the Planning Commission of the City of Anaheim (hereinafter referred to as the “Planning Commission”) did receive a verified petition for Public Convenience or Necessity No. 2016-00131 to permit the sale of alcoholic beverages for on- and off-premises consumption in conjunction with a brew pub with an event space and outdoor dining and recreation (herein referred to as the "Proposed Project") for certain real property located at 2210 and 2220 East Orangewood Avenue in the City of Anaheim, County of Orange, State of California, as generally depicted on the map attached hereto as Exhibit A and incorporated herein by this reference (the “Property”); and WHEREAS, Public Convenience or Necessity No. 2016-00131 is proposed in conjunction with a request for (i) Conditional Use Permit No. 2016-05860 to conditionally permit the construction and operation of a brew pub within an industrial building at the Property, including (a) an event space and an outdoor dining and recreational/entertainment area, (b) the on- and off- premises sale and consumption of alcoholic beverages, and (c) a coordinated sign program; (ii) Variance No. 2016-05066 to permit fewer parking spaces than required by the Zoning Code; and (iii) Conditional Use Permit No. 2016-05890 to conditionally permit off-site parking for a brew pub with outdoor recreation on that certain real property located adjacent to the Property at 2130 East Orangewood Avenue. Public Convenience or Necessity No. 2016-00131, Conditional Use Permit No. 2016-05860, Variance No. 2016-05066, and Conditional Use Permit No. 2016-05890 shall be referred to herein collectively as the “Proposed Project”; and WHEREAS, the Property, consisting of approximately 2.5 acres, is developed with an industrial building. The Land Use Element of the Anaheim General Plan designates the Property for “M-U” Mixed Use land uses. The Property is located in both the “I” Industrial Zone and the Platinum Triangle Mixed Use (PTMU) Overlay Zone. Generally, the development standards and regulations of Chapter 18.20 (Platinum Triangle Mixed Use (PTMU) Overlay Zone) of the Anaheim Municipal Code (the "Code") supersede the regulations of the underlying zone, i.e., that of the “I” Industrial Zone. However, the provisions of Chapter 18.20 (Platinum Triangle Mixed Use (PTMU) Overlay Zone) do not apply to parcels that have been, or are proposed to be, developed entirely under the “I” Industrial Zone, which is the case with the Proposed Project; and WHEREAS, the Planning Commission did hold a public hearing at the Civic Center in the City of Anaheim on November 28, 2016 at 5:00 p.m., notice of said public hearing having been duly given as required by law and in accordance with the provisions of Chapter 18.60 (Procedures) of the Code, to hear and consider evidence for and against the Proposed Project, and to investigate and make findings and recommendations in connection therewith; and - 2 - PC2016-*** WHEREAS, by the adoption of a separate resolution concurrently with but prior in time to this Resolution, this Planning Commission has heretofore found and determined, as the “lead agency” under the California Environmental Quality Act (Public Resources Code Section 21000 et seq.; herein referred to as “CEQA”), that the Proposed Project is within that class of projects which consist of in-fill development meeting the conditions described in Section 15332 of Title 14 of the California Code of Regulations ("CEQA Guidelines") and that, pursuant to Section 15332 of the CEQA Guidelines, is categorically exempt from the provisions of CEQA; and WHEREAS, the Planning Commission, after due inspection, investigation and study made by itself and in its behalf, and after due consideration of all evidence and reports offered at said hearing with respect to the request for Public Convenience or Necessity No. 2016-00131, does find and determine the following facts: 1. On July 11, 1995, the City Council adopted Resolution No. 95R-134 establishing procedures and delegating certain responsibilities to the Planning Commission relating to the determination of "Public Convenience or Necessity" on those certain applications requiring that such determination be made by the local governing body pursuant to applicable provisions of the Business and Professions Code, and prior to the issuance of a license by the Department of Alcoholic Beverage Control ("ABC"). 2. Section 23958 of the Business and Professions Code provides that the ABC shall deny an application for a license if issuance of that license would tend to create a law enforcement problem, or if issuance would result in or add to an "undue concentration" of licenses, except when an applicant has demonstrated that "public convenience or necessity" would be served by the issuance of a license. For purposes of Section 23958.4, "undue concentration" means the case in which the Property is located in an area where any of the following conditions exist: (a) The Property is located in a crime reporting district that has a 20 percent greater number of reported crimes, than the average number of “reported crimes” (as defined in Section 23958.4) as determined from all crime reporting districts within the City of Anaheim. (b) As to on-sale retail license applications, the ratio of on-sale retail licenses to population in the census tract or census division in which the Property is located exceeds the ratio of on-sale retail licenses to population in the county in which the applicant premises are located. (c) As to off-sale retail license applications, the ratio of off-sale retail licenses to population in the census tract or census division in which the Property is located exceeds the ratio of off-sale retail licenses to population in the county. 3. Notwithstanding the existence of the above-referenced conditions, ABC may issue a license if the Planning Commission determines that the "public convenience or necessity" would be served by the issuance. - 3 - PC2016-*** 4. Resolution No. 95R-134 authorizes the City of Anaheim Police Department to make recommendations related to "public convenience or necessity" determinations; and, when the sale of alcoholic beverages for off-premises consumption is permitted by the Code, said recommendations shall take the form of conditions of approval to be imposed on the determination in order to ensure that the sale and consumption of alcoholic beverages does not adversely affect any adjoining land use or the growth and development of the surrounding area. 5. The Property is located within Census Tract No. 761.01 with a population of 8,933 that allows for five off-sale ABC licenses. There are presently five off-sale ABC licenses in the tract. The Property is located in Police Reporting District No. 2228, which has a crime rate that is below the City-wide average. The Police Department evaluates these requests based on the crime rate within a one-quarter mile radius of the Property for the subject site. The crime rate within ¼ mile of this Property is 63% below the City-wide average based upon calls for service. Since there is almost an overconcentration of off-sale licenses in the census tract, a determination of "public convenience or necessity" could be required by ABC when the licenese is issued and has been requested by the applicant for this request. 6. The request to permit alcoholic beverage service for on and off--premises consumption in conjunction with a brew pub would not adversely affect the surrounding land uses and the growth and development of the area in which it is proposed to be located because the Property is currently developed with a beer tasting room in an industrial building and the proposed use of the Premises at the Property is compatible with the existing uses in the surrounding area; and 7. The determination of "Public Convenience or Necessity" can be made based on the finding that the license requested is consistent with the Planning Commission guideline for such determinations and further that the granting of the determination of Public Convenience or Necessity under the conditions imposed will not be detrimental to the health and safety of the citizens of the City of Anaheim. WHEREAS, the Planning Commission determines that the evidence in the record constitutes substantial evidence to support the actions taken and the findings made in this Resolution, that the facts stated in this Resolution are supported by substantial evidence in the record, including testimony received at the public hearing, the staff presentations, the staff report and all materials in the project files. There is no substantial evidence, nor are there other facts, that detract from the findings made in this Resolution. The Planning Commission expressly declares that it considered all evidence presented and reached these findings after due consideration of all evidence presented to it. NOW, THEREFORE, BE IT RESOLVED that the Planning Commission does hereby approve Public Convenience or Necessity No. 2016-00131, contingent upon and subject to (i) approval of Conditional Use Permit No. 2016-05860, Variance No. 2016-05066 and and Conditional Use Permit No. 2016-05890, now pending, and (ii) the conditions of approval set forth in Exhibit B attached hereto and incorporated herein by this reference, which are hereby found to be a necessary prerequisite to the proposed use of the Property in order to preserve the health, safety and general welfare of the citizens of the City of Anaheim. Extensions for further time to complete conditions of approval may be granted in accordance with Section 18.60.170 of the Code. Timing for compliance with conditions of approval may be amended by the Planning - 4 - PC2016-*** Director upon a showing of good cause provided (i) equivalent timing is established that satisfies the original intent and purpose of the condition(s), (ii) the modification complies with the Code, and (iii) the applicant has demonstrated significant progress toward establishment of the use or approved development. BE IT FURTHER RESOLVED, that any amendment, modification or revocation of this permit may be processed in accordance with Chapters 18.60.190 (Amendment to Permit Approval) and 18.60.200 (City-Initiated Revocation or Modification of Permits) of the Code. BE IT FURTHER RESOLVED that the Planning Commission does hereby find and determine that adoption of this Resolution is expressly predicated upon applicant's compliance with each and all of the conditions hereinabove set forth. Should any such condition, or any part thereof, be declared invalid or unenforceable by the final judgment of any court of competent jurisdiction, then this Resolution, and any approvals herein contained, shall be deemed null and void. BE IT FURTHER RESOLVED that approval of this application constitutes approval of the proposed request only to the extent that it complies with the Code and any other applicable City, State and Federal regulations. Approval does not include any action or findings as to compliance or approval of the request regarding any other applicable ordinance, regulation or requirement. THE FOREGOING RESOLUTION was adopted at the Planning Commission meeting of November 28, 2016. Said resolution is subject to the appeal provisions set forth in Chapter 18.60 (Procedures) of the Anaheim Municipal Code pertaining to appeal procedures and may be replaced by a City Council Resolution in the event of an appeal. CHAIRPERSON, PLANNING COMMISSION OF THE CITY OF ANAHEIM ATTEST: SECRETARY, PLANNING COMMISSION OF THE CITY OF ANAHEIM - 5 - PC2016-*** STATE OF CALIFORNIA ) COUNTY OF ORANGE ) ss. CITY OF ANAHEIM ) I, Eleanor Morris, Secretary of the Planning Commission of the City of Anaheim, do hereby certify that the foregoing resolution was passed and adopted at a meeting of the Planning Commission of the City of Anaheim held on November 28, 2016, by the following vote of the members thereof: AYES: COMMISSIONERS: NOES: COMMISSIONERS: ABSENT: COMMISSIONERS: IN WITNESS WHEREOF, I have hereunto set my hand this 28th day of November, 2016. SECRETARY, PLANNING COMMISSION OF THE CITY OF ANAHEIM - 6 - PC2016-*** - 7 - PC2016-*** EXHIBIT “B” DETERMINATION OF PUBLIC CONVENIENCE OR NECESSITY NO. 2016-00131 (DEV2016-00015) NO. CONDITIONS OF APPROVAL RESPONSIBLE DEPARTMENT OPERATIONAL CONDITIONS RELATED TO ALCOHOLIC BEVERAGE SALES 1 That subject alcoholic beverage license shall not be exchanged for a public premise (bar) type license nor shall the establishment be operated as a public premise as defined in Section 23039 of the Business and Professions Code. Police Department 2 At all times when the premise is open for business, the premise shall be maintained as a bona fide restaurant and shall provide a menu containing an assortment of foods normally offered in such restaurant. Police Department 3 Any and all security officers provided shall comply with all State and Local ordinances regulating their services, including, without limitation, Chapter 11.5 of Division 3 of the California Business and Profession Code. (Section 4.16.070 Anaheim Municipal Code) Police Department 4 Petitioner shall not share any profits, or pay any percentage or commission to a promoter or any other person, based upon monies collected as a door charge, cover charge, or any other form of admission charge, including minimum drink orders, or the sale of drinks. Police Department 5 The Can/Outside Retail Shop shall be closed 2 hours prior to events Angel Stadium and remain closed while the event takes place. It may re-open when the event has concluded. Police Department 6 The patio must be fenced and fully enclosed. If there is a pedestrian gate it must be self-closing and have a sign posted on the interior that reads “No alcohol beyond this point.” Police Department 7 Parking lots, driveways, circulation areas, aisles, passageways, recesses and grounds contiguous to buildings, shall be provided with enough lighting to illuminate and make clearly visible the presence of any person on or about the premises during the hours of darkness and provide a safe, secure environment for all persons, property, and vehicles onsite. Police Department 8 Security measures shall be provided to the satisfaction of the Anaheim Polices Department and to prevent disturbances to the neighborhood by excessive noise created by patrons entering or leaving the premises. Police Department - 8 - PC2016-*** NO. CONDITIONS OF APPROVAL RESPONSIBLE DEPARTMENT 9 Music in the outdoor space must be acoustic in nature with no amplification unless a Special Event Permit is granted. A maximum of twelve (12) Special Event Permits shall be permitted per year. Outdoor activities that include alcoholic beverage consumption are subject to review and approval by all applicable City departments. All accessory permits shall be obtained as deemed necessary. The outdoor events shall provide adequate security as required by the Police Department. Police Department and Planning and Building Department, Planning Services Division 10 All entertainment in the outdoor space (music, movies, poetry readings, etc.) shall conclude by 12:00 a.m. Sunday thru Thursday, and 2:00 a.m. Friday and Saturday. Police Department 11 A security plan must be submitted to the Chief of Police or his designee for approval prior to the restaurant opening for business. Areas to be covered/discussed would be:  indoor event/concert/VIP area  game day rivals  eviction of over intoxicated individuals  regular business operations including the outdoor patio area. Police Department 12 Managers/Owners need to call the Department of Alcoholic Beverage control and obtain LEAD (Licensee Education on Alcohol and Drugs Program) Training for themselves and service employees. The number is 714-558-4101. Police Department 13 The permitted event or activity shall not create sound levels which violate any ordinance of the City of Anaheim. Police Department 14 Any Graffiti painted or marked upon the premises or on any adjacent area under the control of the licensee shall be removed or painted over within 24 hours of being applied. Police Department 15 The petitioner shall be responsible for maintaining free of litter the area adjacent to the premises over which they have control, as depicted. Police Department 16 The number of persons occupying the premises shall not exceed the maximum occupancy load as determined by the Anaheim Fire Department. Signs indicating the occupant load shall be posted in a conspicuous place on an approved sign near the main exit from the room. (Section 25.114(a) Uniform Fire Code). Police Department 17 The door(s) shall be kept closed at all times during the operation of the business premises except in cases of emergency. Said door(s) shall not consist of a screen or ventilated security door. Police Department 18 Any violation of the application, or any attached conditions, shall be sufficient grounds to revoke the permit. Police Department - 9 - PC2016-*** NO. CONDITIONS OF APPROVAL RESPONSIBLE DEPARTMENT 19 Petitioner(s) shall police the area under their control in an effort to prevent the loitering of persons about the business premises. Police Department 20 No required parking area shall be fenced-off or otherwise enclosed for outdoor storage uses. Planning and Building Department, Code Enforcement Division 21 The restaurant and brewery shall be operated in accordance with the Statement of Operations submitted as part of this application. Any changes to the business operation as described in that document shall be subject to review and approval by the Planning Director to determine substantial conformance with the Letter of Request and to ensure compatibility with the surrounding uses. Planning and Building Department, Planning Services Division 22 Adequate lighting of parking lots, driveway, circulation areas, aisles, passageways, recesses and grounds contiguous to buildings shall be provided with lighting of sufficient wattage to provide adequate illumination to make clearly visible the presence of any person on or about the premises during the hours of darkness and provide a safe, secure environment for all persons, property, and vehicles on-site. Police Department 23 The applicant shall be responsible for maintaining the area adjacent to the premises over which they have control, in an orderly fashion through the provision of regular maintenance and removal of trash or debris. Any graffiti painted or marked upon the premises or on any adjacent area under the control of the licensee shall be removed or painted over within 24 hours of being applied. Planning and Building Department, Code Enforcement Division GENERAL CONDITIONS 24 The Applicant is responsible for paying all charges related to the processing of this discretionary case application within 30 days of the issuance of the final invoice or prior to the issuance of building permits for this project, whichever occurs first. Failure to pay all charges shall result in delays in the issuance of required permits or may result in the revocation of the approval of this application. Planning and Building Department, Planning Services Division 25 The Applicant shall defend, indemnify, and hold harmless the City and its officials, officers, employees and agents (collectively referred to individually and collectively as “Indemnitees”) from any and all claims, actions or proceedings brought against Indemnitees to attack, review, set aside, void, or annul the decision of the Indemnitees concerning this permit or any of the proceedings, acts or determinations taken, done, or made prior to the decision, or to determine the reasonableness, legality or validity of any condition attached thereto. The Applicant’s indemnification is intended to include, but not be limited to, damages, fees and/or costs awarded against or incurred by Planning and Building Department, Planning Services Division - 10 - PC2016-*** NO. CONDITIONS OF APPROVAL RESPONSIBLE DEPARTMENT Indemnitees and costs of suit, claim or litigation, including without limitation attorneys’ fees and other costs, liabilities and expenses incurred by Indemnitees in connection with such proceeding. 26 The property shall be developed substantially in accordance with plans and specifications submitted to the City of Anaheim by the applicant and which plans are on file with the Planning Department and as conditioned herein. Planning and Building Department, Planning Services Division [DRAFT] ATTACHMENT NO. 3 - 1 - PC2016-*** RESOLUTION NO. PC2016-*** A RESOLUTION OF THE PLANNING COMMISSION OF THE CITY OF ANAHEIM APPROVING CONDITIONAL USE PERMIT NO. 2016-05890 AND MAKING CERTAIN FINDINGS IN CONNECTION THEREWITH (DEV2016-00015) (2130 EAST ORANGEWOOD AVENUE) WHEREAS, the Planning Commission of the City of Anaheim ("Planning Commission") did receive a verified petition to approve (i) Conditional Use Permit No. 2016-05890 to conditionally permit off-site parking for a brew pub with an outdoor dining and recreation area at 2130 East Orangewood Avenue in the City of Anaheim (the Property"),; The Property is generally depicted on the map attached hereto as Exhibit A and incorporated herein by this reference; and WHEREAS, the Property, consisting of approximately 1.3 acres, is developed with an industrial building. The Land Use Element of the Anaheim General Plan designates the Property for “M-U” Mixed Use land uses. The Property is located in both the “I” Industrial Zone and the Platinum Triangle Mixed Use (PTMU) Overlay Zone. Generally, the development standards and regulations of Chapter 18.20 (Platinum Triangle Mixed Use (PTMU) Overlay Zone) of the Anaheim Municipal Code (the "Code") supersede the regulations of the underlying zone, i.e., that of the “I” Industrial Zone. However, the provisions of Chapter 18.20 (Platinum Triangle Mixed Use (PTMU) Overlay Zone) do not apply to parcels that have been, or are proposed to be, developed entirely under the “I” Industrial Zone, which is the case with the Proposed Project; and WHEREAS, Conditional Use Permit No. 2016-05890 is proposed in conjunction with a request for a determination of "Public Convenience or Necessity" to conditionally permit the sale of alcoholic beverages for on- and off-premises consumption in conjunction with a brew pub at the Property, which request is designated as "Public Convenience or Necessity No. 2016-00131". Conditional Use Permit No. 2016-05860, Variance No. 2016-05066, Public Convenience or Necessity No. 2016-00131 and Conditional Use Permit No. 2016-05890 shall be referred to herein collectively as the “Proposed Project”; and WHEREAS, the Planning Commission did hold a public hearing at the Civic Center in the City of Anaheim on November 28, 2016 at 5:00 p.m., notice of said public hearing having been duly given as required by law and in accordance with the provisions of Chapter 18.60 (Procedures) of the Code, to hear and consider evidence for and against the Proposed Project and to investigate and make findings and recommendations in connection therewith; and WHEREAS, pursuant to and in accordance with the provisions of the California Environmental Quality Act (Public Resources Code Section 21000 et seq.; herein referred to as “CEQA”), the State of California Guidelines for Implementation of the California Environmental Quality Act (Title 14 of the California Code of Regulations; herein referred to as the "CEQA Guidelines"), and the City's Local CEQA Procedure Manual, the City is the "lead agency" for the preparation and consideration of environmental documents for the Proposed Project; and - 2 - PC2016-*** WHEREAS, this Planning Commission finds and determines that the Proposed Project is within that class of projects (i.e., Class 32 – In-fill Development Projects) which consists of in- fill development meeting the conditions described in Section 15332 of the CEQA Guidelines. Specifically, the Proposed Project (a) is consistent with the applicable General Plan designation and all applicable General Plan policies and is consistent with the applicable zoning designation and regulations, (b) is no more than five acres in size substantially surrounded by urban uses, (c) has no value as a habitat for endangered, rare or threatened species, (d) would not result in significant effects relating to traffic, noise, air quality, or water quality, and (e) the Property can be adequately served by all required utilities and public services. Accordingly, pursuant to Section 15332 of the CEQA Guidelines, this Planning Commission finds and determines that the Proposed Project will not cause a significant effect on the environment and is, therefore, categorically exempt from the provisions of CEQA; and WHEREAS, the Planning Commission, after due inspection, investigation and study made by itself and in its behalf, and after due consideration of all evidence and reports offered at said hearing pertaining to the request for Conditional Use Permit No. 2016-05890, does find and determine the following facts: 1. The proposed request to permit off-site parking for a brew pub with an outdoor dining and recreation area is an allowable use within the "I" Industrial Zone under Section 18.10.030 (Uses) of Chapter 18.10 (Industrial Zone) of the Code, subject to a conditional use permit and the zoning and development standards of the "I" Industrial Zone. 2. The use proposed under Conditional Use Permit No. 2016-05890, under the conditions imposed, are compatible with the existing industrial uses in the surrounding area. 3. The size and shape of the site for the use proposed under Conditional Use Permit No. 2016-05890 are, under the conditions imposed, adequate to allow the full development of the proposed uses in a manner not detrimental to the particular area or to the health and safety because the facilities on the Property will adhere to all required land use standards. 4. The traffic generated by the uses proposed under Conditional Use Permit No. 2016- 05890, under the conditions imposed, will not impose an undue burden upon the streets and highways designed and improved to carry the traffic in the area because the traffic generated by this use will not exceed the anticipated volumes of traffic on the surrounding streets. 5. The granting of Conditional Use Permit No. 2016-05890, under the conditions imposed, will not be detrimental to the health and safety of the citizens of the City of Anaheim as the proposed project will be compatible with the surrounding area through conditions of approval for the use and is not a health or safety risk to the citizens of the City of Anaheim. WHEREAS, the Planning Commission determines that the evidence in the record constitutes substantial evidence to support the actions taken and the findings made in this Resolution, that the facts stated in this Resolution are supported by substantial evidence in the record, including testimony received at the public hearing, the staff presentations, the staff report and all materials in the project files. There is no substantial evidence, nor are there other facts, that detract from the findings made in this Resolution. The Planning Commission expressly declares that it considered all evidence presented and reached these findings after due consideration of all evidence presented to it. - 3 - PC2016-*** NOW, THEREFORE, BE IT RESOLVED that the Planning Commission does hereby approve Conditional Use Permit No. 2016-05890, contingent upon and subject to (i) approval of Conditional Use Permit No. 2016-05860, Variance No. 2016-05066 and Public Convenience or Necessity No. 2016-00131 now pending, and (ii) the conditions of approval set forth in Exhibit B attached hereto and incorporated herein by this reference, which are hereby found to be a necessary prerequisite to the proposed use of the Property under Conditional Use Permit No. 2016-05890 in order to preserve the health, safety and general welfare of the citizens of the City of Anaheim. Extensions for further time to complete conditions of approval may be granted in accordance with Section 18.60.170 of the Code. Timing for compliance with conditions of approval may be amended by the Planning Director upon a showing of good cause provided (i) equivalent timing is established that satisfies the original intent and purpose of the condition, (ii) the modification complies with the Code, and (iii) the applicant has demonstrated significant progress toward establishment of the use or approved development. BE IT FURTHER RESOLVED that any amendment, modification or revocation of this permit may be processed in accordance with Chapters 18.60.190 (Amendment to Permit Approval) and 18.60.200 (City-Initiated Revocation or Modification of Permits) of the Code. BE IT FURTHER RESOLVED that the Planning Commission does hereby find and determine that adoption of this Resolution is expressly predicated upon applicant's compliance with each and all of the conditions hereinabove set forth. Should any such condition, or any part thereof, be declared invalid or unenforceable by the final judgment of any court of competent jurisdiction, then this Resolution, and any approvals herein contained, shall be deemed null and void. BE IT FURTHER RESOLVED that approval of this application constitutes approval of the proposed request only to the extent that it complies with the Code and any other applicable City, State and Federal regulations. Approval does not include any action or findings as to compliance or approval of the request regarding any other applicable ordinance, regulation or requirement. THE FOREGOING RESOLUTION was adopted at the Planning Commission meeting of November 28, 2016. Said resolution is subject to the appeal provisions set forth in Chapter 18.60 (Procedures) of the Anaheim Municipal Code pertaining to appeal procedures and may be replaced by a City Council Resolution in the event of an appeal. CHAIRPERSON, PLANNING COMMISSION OF THE CITY OF ANAHEIM ATTEST: SECRETARY, PLANNING COMMISSION OF THE CITY OF ANAHEIM - 4 - PC2016-*** STATE OF CALIFORNIA ) COUNTY OF ORANGE ) ss. CITY OF ANAHEIM ) I, Eleanor Morris, Secretary of the Planning Commission of the City of Anaheim, do hereby certify that the foregoing resolution was passed and adopted at a meeting of the Planning Commission of the City of Anaheim held on November 28, 2016, by the following vote of the members thereof: AYES: COMMISSIONERS: NOES: COMMISSIONERS: ABSENT: COMMISSIONERS: IN WITNESS WHEREOF, I have hereunto set my hand this 28th day of November, 2016. SECRETARY, PLANNING COMMISSION OF THE CITY OF ANAHEIM - 5 - PC2016-*** - 6 - PC2016-*** EXHIBIT “B” CONDITIONAL USE PERMIT NO. 2016-05890 (DEV2016-00015) NO. CONDITIONS OF APPROVAL RESPONSIBLE DEPARTMENT PRIOR TO ISSUANCE OF BUILDING PERMITS 1 The building shall be equipped with an alarm system (silent or audible). Police Department 2 Complete a Burglary/Robbery Alarm Permit application, Form APD 516, and return it to the Police Department prior to initial alarm activation. This form is available at the Police Department front counter, or it can be downloaded from the following web site: http://www.anaheim.net/article.asp?id=678 Police Department 3 All exterior doors to have adequate security hardware, e.g. deadbolt locks. Police Department OPERATIONAL CONDITIONS 4 Any and all security officers provided shall comply with all State and Local ordinances regulating their services, including, without limitation, Chapter 11.5 of Division 3 of the California Business and Profession Code. (Section 4.16.070 Anaheim Municipal Code) Police Department 5 Parking lots, driveways, circulation areas, aisles, passageways, recesses and grounds contiguous to buildings, shall be provided with enough lighting to illuminate and make clearly visible the presence of any person on or about the premises during the hours of darkness and provide a safe, secure environment for all persons, property, and vehicles onsite. Police Department 6 Security measures shall be provided to the satisfaction of the Anaheim Polices Department and to prevent disturbances to the neighborhood by excessive noise created by patrons entering or leaving the premises. Police Department 7 Any Graffiti painted or marked upon the premises or on any adjacent area under the control of the licensee shall be removed or painted over within 24 hours of being applied. Police Department 8 The petitioner shall be responsible for maintaining free of litter the area adjacent to the premises over which they have control, as depicted. Police Department 9 The number of persons occupying the premises shall not exceed the maximum occupancy load as determined by the Anaheim Fire Department. Signs indicating the occupant load shall be posted in a conspicuous place on an approved sign near the main exit from the room. (Section 25.114(a) Uniform Fire Code). Police Department - 7 - PC2016-*** NO. CONDITIONS OF APPROVAL RESPONSIBLE DEPARTMENT 10 The permitted event or activity shall not create sound levels which violate any ordinance of the City of Anaheim. Police Department 11 Any violation of the application, or any attached conditions, shall be sufficient grounds to revoke the permit. Police Department 12 Petitioner(s) shall police the area under their control in an effort to prevent the loitering of persons about the business premises. Police Department 13 No required parking area shall be fenced-off or otherwise enclosed for outdoor storage uses. Planning and Building Department, Code Enforcement Division 14 Adequate lighting of parking lots, driveway, circulation areas, aisles, passageways, recesses and grounds contiguous to buildings shall be provided with lighting of sufficient wattage to provide adequate illumination to make clearly visible the presence of any person on or about the premises during the hours of darkness and provide a safe, secure environment for all persons, property, and vehicles on-site. Police Department 15 All truck maneuvers shall be performed on-site. Trucks shall not back in from or back up into Dupont Drive. Public Works, Traffic Engineering 16 A valet parking operator shall be employed on days when special events are scheduled to occur in the evening or when lunchtime event attendance will exceed 50 guests. On days when valet service will be utilized, access to the building at 2130 East Orangewood Avenue shall be controlled from the beginning of the operating day. Valet attendants shall begin serving customers by noon or one hour before the start of the event, whichever is earlier. Planning and Building Department, Planning Services Division 17 The off-site parking shall be limited to the patrons and employees of Golden Road Brewing. An executed agreement to provide off-site parking on the property to the east, as described in the parking study, in a form satisfactory to the City Attorney, shall be submitted to the Planning Services Division. Said agreement shall remain in full force and effect at all times. The parking shall not be used for Angel Stadium event parking at any time. Planning and Building Department, Planning Services Division 18 The applicant shall be responsible for maintaining the area adjacent to the premises over which they have control, in an orderly fashion through the provision of regular maintenance and removal of trash or debris. Any graffiti painted or marked upon the premises or on any adjacent area under the control of the licensee shall be removed or painted over within 24 hours of being applied. Planning and Building Department, Code Enforcement Division - 8 - PC2016-*** NO. CONDITIONS OF APPROVAL RESPONSIBLE DEPARTMENT GENERAL CONDITIONS 19 The Applicant is responsible for paying all charges related to the processing of this discretionary case application within 30 days of the issuance of the final invoice or prior to the issuance of building permits for this project, whichever occurs first. Failure to pay all charges shall result in delays in the issuance of required permits or may result in the revocation of the approval of this application. Planning and Building Department, Planning Services Division 20 The Applicant shall defend, indemnify, and hold harmless the City and its officials, officers, employees and agents (collectively referred to individually and collectively as “Indemnitees”) from any and all claims, actions or proceedings brought against Indemnitees to attack, review, set aside, void, or annul the decision of the Indemnitees concerning this permit or any of the proceedings, acts or determinations taken, done, or made prior to the decision, or to determine the reasonableness, legality or validity of any condition attached thereto. The Applicant’s indemnification is intended to include, but not be limited to, damages, fees and/or costs awarded against or incurred by Indemnitees and costs of suit, claim or litigation, including without limitation attorneys’ fees and other costs, liabilities and expenses incurred by Indemnitees in connection with such proceeding. Planning and Building Department, Planning Services Division 21 The property shall be developed substantially in accordance with plans and specifications submitted to the City of Anaheim by the applicant and which plans are on file with the Planning Department and as conditioned herein. Planning and Building Department, Planning Services Division October 19, 2016 City of Anaheim Planning Department Planning Services Division 200 South Anaheim Blvd., 1st Floor Anaheim, CA 92805 Attn: Amy Vazquez Contract Planner Subj: Letter of Operation Anaheim Location‐Alternate Design New Pub/Restaurant/Brewery Project‐ 2210/2220 East Orangewood Ave. Transmittal #1134‐03 Dear Amy, Golden Road Brewing Co. (GRB) is pleased to re‐submit the attached development proposal for 2210/2220 E. Orangewood Ave. The subject property is located in the Platinum Triangle, directly south of Angel Stadium of Anaheim, in a rapidly changing mixed use neighborhood. The scope of this development proposal includes selective site and building upgrades to an existing 58,500 SF unoccupied warehouse consisting of (2) existing concrete structures with a common demising wall. The eastern half of the existing building (2220 East Orangewood Avenue) will undergo a phased demolition, removing the roof, roof structure and (3) walls, leaving the existing slab as a construction staging area. The existing slab will eventually be demolished and salvaged for re‐use as outdoor patio paving material. The remaining structure (2210 East Orangewood Avenue) will largely be left intact, with areas of selective demolition to provide new openings in the existing building envelope, as well as extend utilities for future use inside the building. Potential utility upgrades are planned to the existing electrical, sewer, water, and gas utilities. Fire‐sprinkler upgrades will occur as well as HVAC and exterior lighting improvements. All parking needs will be supplied by property owned or leased by GRB. Between the 2210 E Orangewood property and 2130 E Orangewood property the project should be self‐sufficient for all of its parking needs. Please see the parking study performed by LSA Associates, Inc. for additional information. Customers who park at 2130 E Orangewood will use the crosswalk at the intersection of E Orangewood Ave and S. Dupont Dr. The eastern and western parking lots of 2210 E Orangewood will be upgraded to provide parking spaces. The existing parking spaces at the north area of the property will be removed allowing a wide assembly area, which will easily accommodate the planned Orangewood ultimate Right of way. The freestanding retail oriented structure (see Fig. 1 ‘150 ‐ Can Shop’) ‐ anchors the northwest corner of the property, acting as the main pedestrian entry to the site with integral signage and fencing, street ATTACHMENT NO. 4 level retail, bike parking and layered landscaping and planting. Pedestrians access the site on boardwalk and salvaged hardscape materials, passing through a gated ‘portal’ adjacent to a small retail point of sale. The desire for the boardwalk entrance and bike parking is to be treated as an extension of public space from the public sidewalk. The Can Shop point of sale will be manned during business hours, selling branded merchandise and retail packaged beer in cans and bottles. Beer sales in the Can Shop will be suspended as recommended by the Police Department in coordination with events at Angel’s Stadium. The Can Shop will have one entrance as shown in Fig. 1 ‘150 – Can Shop’, which will be locked when the Can Shop and/or restaurant is closed. The main northwest entry will be secured with a pivot gate, so whenever the restaurant is closed, the main entrance will be easily secured. The presence of employees in the Can Shop will manage the main entrance, providing a light level of security as well as directional assistance to customers. In the mornings, the indoor dining and outdoor area will welcome customers with a quiet breakfast and coffee dining experience, serving both the casual breakfast and local telecommuting customers. The outdoor seating areas will include 3 outdoor bars and hammock grove, kid‐safe play area, dog run, community and semi‐private seating, swings, orange trees, fire pits, projector screen, TVs, portable and fixed space heaters, and an exterior platform stage for permitted events. For a detailed explanation of how areas will be programmed, please see Figure 1 below. GRB is proposing to operate the brewing facilities from 7:00 am until 6:00 pm every day of the week, and the restaurant/pub facilities from 7:00 am until 2:00 am, every day of the week. At the maximum expected operation, an estimated thirty‐one personnel will be onsite at all times: three bartenders, one site manager, one operations manager, one restaurant manager, ten servers, seven food preparation workers, one general worker, one brew master, five brewers, and one security officer. During operations, employees will have access to all areas, but the public will primarily have access only to the pub, restaurant, and outdoor garden. The barrel room is primarily for storing and ageing barrel aged beer, but on occasion will also host private events. These private events will include weddings, music events, and other planned gatherings. The sum of people in the barrel room, and VIP Room will not exceed 170 people to assure compliance with the City’s parking requirements. All facilities will be constructed to the latest California Building Code and Disabled Access Requirements, along with City of Anaheim Amendments. The goals of the facility are safety, cleanliness, proper food‐ preparation standards, and good‐neighboring policies, which will offer positive social gathering activities for the city residents. Thank you for this opportunity. Golden Road Brewing Brandon Smith Project Manager Figure 1 – Indoor and Outdoor Program Reference Guide All reference numbers below can be found on Sheet A2.11 Ref. # SPACE DESCRIPTION 01 Outdoor Dining Located north of the building, this area is a full service dining area complete with community style seating, 4‐6 seater tables, and fire pit tables. Outdoor dining area operates with similar service hours as Dining Room 101. 02 Bocce and Family Room The family room is a small outdoor area adjacent to the bocce ball court, for semi private seating during bocce games. 03 Hammock Grove The hammock grove is a sand area with hammocks for informal group seating. 04 Outdoor Gaming Area The gaming area is a turf area designated for a variety of outdoor games and activities. Yard games including ping pong, life sized connect four, life sized battleship, and corn hole will be available to anyone who wants to play. 05 Beach Fire Pit Precast concrete fire pit (natural gas) recalling those found on local Pacific Ocean beaches, surrounded by sand and Adirondack chairs. 06 Outdoor Recreational Space Outdoor seating area for fast casual service, with a mix of large communal tables, smaller (4) top tables and container planting distributed on a hardscaped surface. 07 Stage The stage is a multi‐functional wood framed deck 21" above general grade. The stage will support acoustic musical performances, projected sports events and selected films on evenings and weekends. Special Event Permits will be secured for performances with amplified music. 08 Kid Safe Play Area Semi private sandy play area with informal boundary of plantings and climbing/scrambling equipment on (3) sides 09 Dog Run Modest fenced enclosure with synthetic (washable) turf for guests with pets 10 Stormwater Treatment Area Proposed water quality basin ‐ See Civil sheet C‐3 for reference. 11 Outdoor Storage Outdoor material storage and handling area, screened with fencing. 12 Trash and Recycling Collection Gated and screened area for trash and recycling bins. 13 Drop Off and Pick up Located next to the main entry and Can Shop (150), this area has alternate hardscape paving surrounding a branded medallion for vehicular pick‐up, drop‐off, and turnaround. 14 Boiler and Chiller Fenced outdoor mechanical enclosure with overhead canopy 15 Tool Shed Semi enclosed structures with back bar equipment, draft faucets, wall mounted TVs, and POS service stations secured by shuttered doors. 101 Dining Room Full service restaurant, with a variety of seating, including (Outdoor Dining Area 01). During the morning hours, the indoor dining room will be casual service, ordering at the cafe bar POS. During the lunch and evening hours, patrons will experience hosted full table service. 104 Roastery Flexible work area with natural gas coffee roaster and flue, directly adjacent to dry storage area and café bar counter. 106 Tank Bar The Tank Bar will have between 8 and 15 fully functional fermenters that double as serving tanks. This will operate as an indoor bar, but the beer in these tanks will be extremely rare and experimental. Our desire is to use the Tank Bar as an extension of education about beer and our brewery. Patrons will have a direct connection to brewers that will educate them on building beer profiles, ingredients, how to taste, what they are tasting, aromas, flavors and off‐flavors, carbonation, and anything else they can ask. 109 Main Kitchen The Kitchen is our main kitchen where all food service for the entire project will flow. This will be staffed appropriately to serve our operating hours. 113 Draft Cold Box The draft cold box will store kegs for draft beer intended to be consumed on the property. 114 Barrel Vault The barrel vault is where we will age our barrel aged beer as well as host private events, concerts, weddings, and other scheduled functions. 117 VIP Room The VIP room is a small private event room that will be available for rent by patrons or businesses. 119‐127 Office The office area will house Golden Road employees. There is a mix of open style offices, private offices, break areas, conference areas, and a media room. The media room is intended for hosting smaller media interviews as well as small meetings. 141 Cold Box The cold box is for storage of beer that will eventually leave the Anaheim brewery. 144 Feature The feature is planned to be an indoor/outdoor golf simulator. The simulator will hold 8 people at max and will be available with reservations. The eastern wall will be open to the outdoor area so other patrons can see the activity inside. 131 Prep Kitchen The Prep Kitchen will serve as food preparation and catering kitchen with dry storage and cold storage for private events held in the barrel vault. The staffing will vary based off the level of service for private events, but will generally be staffed in the non‐peak hours between 5AM and 10AM to prepare food for the main kitchen. 150 Can Shop In an effort to activate the Orangewood Ave frontage, we would sell merchandise in a unique freestanding structure that serves more as a welcoming venue to the overall property. We will sell merchandise as well as retail beer. Beer sales will be suspended in the Can Shop as recommended by the Police Department. October 2016 PARKING ST UDY GOLDEN ROAD BREWERY CITY OF ANAHEIM, CALIFORNIA ATTACHMENT NO. 5 October 2016 PARKING ST UDY GOLDEN ROAD BREWERY CITY OF ANAHEIM, CALIFORNIA Submitted to: Golden Road Brewery 2210 East Orangewood Avenue Anaheim, California 92806 Prepared by: LSA Associates, Inc. 20 Executive Park, Suite 200 Irvine, California 92614 (949) 553-0666 Project No. GRB1601 P:\GRB1601\Parking Study4.docx «10/19/16» i TABLE OF CONTENTS INTRODUCTION .................................................................................................................................. 1 PROJECT DESCRIPTION .................................................................................................................... 1 OFF-SITE PARKING ............................................................................................................................ 4 ORANGEWOOD AVENUE WIDENING ............................................................................................ 5 VALET PARKING ................................................................................................................................ 5 ON-STREET PARKING........................................................................................................................ 8 MUNICIPAL CODE PARKING REQUIREMENTS ........................................................................... 8 PARKING DEMAND ............................................................................................................................ 9 PARKING MANAGEMENT PLAN ................................................................................................... 10 FINDINGS ........................................................................................................................................... 11 CONCLUSION .................................................................................................................................... 12 FIGURES Figure 1: Project Location ..................................................................................................................... 2 Figure 2: Site Plan .................................................................................................................................. 3 Figure 3: Parking Layout after Orangewood Widening ......................................................................... 6 Figure 4: Valet Stacking ......................................................................................................................... 7 TABLES Table A: Municipal Code Parking Requirements ................................................................................... 8 Table B: Anticipated Parking Demand ................................................................................................. 10 Table C: Weekday Time of Day with Reduced Parking for Travel Mode ......................................... A-1 APPENDICES A: SHARED PARKING TABLE B: GATE STACKING ANALYSIS L S A A S S O C I A T E S , I N C .L S A A S S O C I A T E S , I N C .L S A A S S O C I A T E S , I N C .L S A A S S O C I A T E S , I N C . OOOO C T O B E RC T O B E RC T O B E RC T O B E R 2 0 1 62 0 1 62 0 1 62 0 1 6 P A R K I N G S T U D YP A R K I N G S T U D YP A R K I N G S T U D YP A R K I N G S T U D Y G O L D E N R O A D B R E W E R YG O L D E N R O A D B R E W E R YG O L D E N R O A D B R E W E R YG O L D E N R O A D B R E W E R Y C I T Y O F A N A H E I M , C A LC I T Y O F A N A H E I M , C A LC I T Y O F A N A H E I M , C A LC I T Y O F A N A H E I M , C A L I F O R N I AI F O R N I AI F O R N I AI F O R N I A P:\GRB1601\Parking Study4.docx «10/19/16» 1 GOLDEN ROAD BREWERY PARKING STUDY LSA Associates, Inc. (LSA) has prepared the following analysis to identify the anticipated future parking demand for the Golden Road Brewery project (project) in the City of Anaheim (City). The parking supply is compared to the Anaheim Municipal Code (AMC) parking requirements and to the anticipated parking demand. INTRODUCTION Golden Road Brewery is located within the Orangewood District in the Platinum Triangle. The City has planned the Platinum Triangle to be a vibrant mixed-use neighborhood and a new downtown for Orange County. When completed, the Platinum Triangle will be home to 28,000 residents. Residential development is occurring in the immediate vicinity of Golden Road Brewery. On March 5, 2016, the final phase of the Gateway Apartments opened. The George Apartments are under construction immediately across the street. The Platinum Center project proposes 255 apartments as part of its first phase. All of these residences will be within a 5-minute walk of Golden Road Brewery. The project proposes renovations to 2210 East Orangewood Avenue and demolition of 2220 East Orangewood Avenue. Interior renovations to 2210 East Orangewood Avenue would provide a restaurant, a tank bar/tasting room, brewing operations, and offices. Outdoor space created by the demolition of 2220 East Orangewood Avenue would provide recreation opportunities for the restaurant patrons who want to extend their visit and some seating for walk-up fast casual food and beverage service. Because the project includes brewing operations and offices that have their peak parking demand at different times than the restaurant’s peak parking demand, it is anticipated that total parking demand will be less than the combination of each single land use’s parking demand calculated by AMC parking rates. In addition, the location of the project is within walking distance of many potential customers. The project is seeking a parking variance in accordance with AMC Section 18.42.110. When seeking a variance from the parking requirements established by AMC Section 18.42.40, the City requires that five findings be made. This report provides data to support these findings. PROJECT DESCRIPTION Golden Road Brewery is currently located at 2210 East Orangewood Avenue in the City of Anaheim. The project is bounded by East Orangewood Avenue to the north, Dupont Drive to the east and west, and industrial uses to the south. Figure 1 illustrates the location of the proposed project. The project proposes to renovate the current building and demolish the adjacent building (2220 East Orangewood Avenue) for additional outdoor space. A site plan for the proposed project is provided as Figure 2. SOURCE Google Earth: FEET 2001000 N FIGURE1 Project Location I:\GRB1601\G\Location.cdr (9/23/2016) Golden Road Brewery Orangewood AveOrangewood Ave Dupont DrDupont Dr Project Site Project Site Off Site Parking Off Site Parking Dupont DrDupont Dr Or a n g e w o o d A v e Or a n g e w o o d A v e N FIGURE2 Site Plan I: \ G R B 1 6 0 1 \ G \ S i t e P l a n . c d r ( 9 / 2 2 / 2 0 1 6 ) Golden R o a d B r e w e r y SO U R C E S c o t t / E d w a r d s A r c h i t e c t u r e : FE E T 20 0 10 0 0 Pr o j e c t Si t e L S A A S S O C I A T E S , I N C .L S A A S S O C I A T E S , I N C .L S A A S S O C I A T E S , I N C .L S A A S S O C I A T E S , I N C . OOOO C T O B E RC T O B E RC T O B E RC T O B E R 2 0 1 62 0 1 62 0 1 62 0 1 6 P A R K I N G S T U D YP A R K I N G S T U D YP A R K I N G S T U D YP A R K I N G S T U D Y G O L D E N R O A D B R E W E R YG O L D E N R O A D B R E W E R YG O L D E N R O A D B R E W E R YG O L D E N R O A D B R E W E R Y C I T Y O F A N A H E I M , C A LC I T Y O F A N A H E I M , C A LC I T Y O F A N A H E I M , C A LC I T Y O F A N A H E I M , C A L I F O R N I AI F O R N I AI F O R N I AI F O R N I A P:\GRB1601\Parking Study4.docx «10/19/16» 4 The project proposes to modify the existing building at 2210 East Orangewood Avenue to include space for brewing operations, a restaurant, a tasting room, offices, and a space for special events within the barrel aging vault. The special event space will be limited to a maximum of 165 fixed seats. Just outside the restaurant, an outdoor dining area is planned adjacent to Orangewood Avenue. Additional outdoor areas created by the demolition of 2220 East Orangewood Avenue will provide a variety of recreation options, including yard games and hammocks. Outdoor seating for fast casual dining is planned within the new outdoor space. The outdoor seating areas will not offer table service in the same way that a restaurant’s outdoor dining patio would. Similar to customers within the recreation areas, customers in the outdoor seating areas will be able to walk up to an order counter to purchase food or beverages. Four 10-seat picnic tables and six 4-seat round tables are planned for the outdoor seating areas. The site plan indicates that the existing driveway on Orangewood Avenue would be closed as part of the proposed project. Existing driveways on Dupont Drive (west) and Dupont Drive (east) would be retained and provide access to two self-park parking lots. Self-park parking with 26 spaces (4 of which are reserved for disabled parking) will be accessible from the driveway on Dupont Drive (west). Self-park parking with 49 spaces (4 of which are reserved for disabled parking) will be accessible from the driveway on Dupont Drive (east). This provides a total of 75 spaces on site. Off-Site Parking The project includes off-site parking located at 2130 East Orangewood Avenue. The proposed project has a 10-year lease of this site. This site contains an approximately 28,000-square-foot (sf) warehouse building with an adjacent parking lot. The parking lot has three existing driveways: one on Orangewood Avenue and two on Dupont Drive (west). The northern driveway on Dupont Drive (west) is approximately 50 feet (ft) from Orangewood Avenue. The southern driveway on Dupont Drive (west) is approximately 285 ft from Orangewood Avenue but is currently closed with a gate and unused. The northern driveway on Dupont Drive (west) would be located less than the minimum distance from the proposed traffic signal at Dupont Drive/Orangewood Avenue. Therefore, the project proposes to close the northern driveway on Dupont Drive (west) and use the driveway on Orangewood Avenue and the southern driveway on Dupont Drive (west). Figure 2 shows 120 self-park parking spaces at this off-site location. Vehicles arriving from eastbound Orangewood Avenue will be able to enter the parking lot at the right-in/right-out driveway on Orangewood Avenue. Vehicles arriving from westbound Orangewood Avenue will be able to access Dupont Drive (west) from the planned traffic signal at Dupont Drive (west)/Orangewood Avenue and then access the parking lot from the southern driveway. Parking spaces will be available both outside and inside the building. The existing light industrial building has three 11 ft wide bay doors along the eastern wall that would allow vehicle access to the interior of the building. The interior will be arranged for one-way clockwise travel. Vehicles would enter at the southern bay door and exit at the middle bay door. Only six parking spaces would be located where vehicles exiting the building would interact with vehicles entering the building. It is anticipated that the driveway on Dupont Drive (west) would be the primary egress for vehicles from the parking lot because this route would lead to a traffic signal that would allow them to travel either east or west on Orangewood Avenue. L S A A S S O C I A T E S , I N C .L S A A S S O C I A T E S , I N C .L S A A S S O C I A T E S , I N C .L S A A S S O C I A T E S , I N C . OOOO C T O B E RC T O B E RC T O B E RC T O B E R 2 0 1 62 0 1 62 0 1 62 0 1 6 P A R K I N G S T U D YP A R K I N G S T U D YP A R K I N G S T U D YP A R K I N G S T U D Y G O L D E N R O A D B R E W E R YG O L D E N R O A D B R E W E R YG O L D E N R O A D B R E W E R YG O L D E N R O A D B R E W E R Y C I T Y O F A N A H E I M , C A LC I T Y O F A N A H E I M , C A LC I T Y O F A N A H E I M , C A LC I T Y O F A N A H E I M , C A L I F O R N I AI F O R N I AI F O R N I AI F O R N I A P:\GRB1601\Parking Study4.docx «10/19/16» 5 At the northeast corner of the 2130 East Orangewood Avenue lot, a pedestrian path will be provided that leads to the waiting area for the crosswalk at the intersection of Dupont Drive (west)/ Orangewood Avenue. Pedestrians would travel between off-site parking and the proposed project using this crosswalk. Including the off-site parking area, the project will provide 195 parking spaces at project opening. However, the Platinum Triangle is a dynamic area and changes are anticipated shortly after project opening. Orangewood Avenue Widening The Orangewood Avenue widening project would add one travel lane in each direction, thereby increasing the number of lanes on Orangewood Avenue from four to six. At the intersection of Dupont Drive (west)/Orangewood Avenue, the Orangewood Avenue widening project would also add an exclusive eastbound right-turn lane. These roadway improvements are included in the Platinum Triangle Implementation Plan. At 2130 East Orangewood Avenue, the widening project will remove at least 15 ft from the area available for parking on the north side of the parking lot. Figure 3 illustrates the planned reconfiguration of the parking areas that would occur due to the Orangewood Avenue widening project. As Figure 3 shows, insufficient space would remain for the existing perpendicular parking spaces to be replaced with perpendicular parking spaces. Instead, five parallel parking spaces could be located along the northern edge of the property. At this time, it is believed that providing a 20 ft two-way drive aisle will be possible with modification to the planter adjacent to the building. The project is proposing to relocate the Orangewood Avenue driveway 18 ft from the western edge of the property line. This would still place the driveway curb at least 110 ft from the street curb as suggested by City of Anaheim Standard Detail 473. The necessity to reconstruct the southwest corner of Dupont Drive (west)/Orangewood Avenue provides an opportunity to place a substantial pedestrian path between the parking lot and the waiting area for the crosswalk. After the Orangewood Avenue Widening project, the proposed project will provide 184 self-park parking spaces. Valet Parking As will be discussed further in the Parking Management section, the project proposes to employ a valet parking plan during special events. Self-parking around 2210 East Orangewood Avenue would be available on a first-come first-served basis while the off-site parking lot at 2130 East Orangewood Avenue would be used exclusively for valet. On days when valet parking will be used, parking at the off-site parking lot would need to be controlled by the valet operator from the beginning of the operating day. Cones would be placed across the Orangewood Avenue driveway along with a sandwich board sign that directs drivers to turn right at Dupont Drive (west) and enter the lot from the Dupont Drive driveway. The valet stand would be placed near the bay door entrance to the building. Figure 4 illustrates the use of 2130 East Orangewood Avenue during valet operations. Figure 4 shows 135 standard/passenger vehicle parking spaces and 29 compact parking spaces. Compact parking spaces have a minimum length of 15 ft and are sufficient for a wide variety of cars on the market today (e.g., Ford Focus, Honda Civic). While the City no longer includes compact parking spaces for self-parking in the municipal code, valet operators have the ability to select a parking location based on the size of a vehicle to fit within their parking plan. For example, if an oversized vehicle (e.g., a SOURCE Urban Resource: FEET 50250 N FIGURE3 Parking LayoutAfter Orangewood Widening I:\GRB1601\G\Parking Layout Post-Widening.cdr (9/22/2016) Golden Road Brewery SOURCE: Base Map- PBL Engineering FEET 50250 N FIGURE4 Valet Stacking I:\GRB1601\G\Valet Stacking.cdr (9/23/2016) Golden Road Brewery LEGEND - Valet Parking Space 75’ ONLY VALET STAND V 75’75’ VALET STAND V 15’15’ Orangewood Ave. Du p o n t D r . EXIT L S A A S S O C I A T E S , I N C .L S A A S S O C I A T E S , I N C .L S A A S S O C I A T E S , I N C .L S A A S S O C I A T E S , I N C . OOOO C T O B E RC T O B E RC T O B E RC T O B E R 2 0 1 62 0 1 62 0 1 62 0 1 6 P A R K I N G S T U D YP A R K I N G S T U D YP A R K I N G S T U D YP A R K I N G S T U D Y G O L D E N R O A D B R E W E R YG O L D E N R O A D B R E W E R YG O L D E N R O A D B R E W E R YG O L D E N R O A D B R E W E R Y C I T Y O F A N A H E I M , C A LC I T Y O F A N A H E I M , C A LC I T Y O F A N A H E I M , C A LC I T Y O F A N A H E I M , C A L I F O R N I AI F O R N I AI F O R N I AI F O R N I A P:\GRB1601\Parking Study4.docx «10/19/16» 8 large SUV or extended pick-up) requires valet parking, the valet operator would have the option to park these vehicles in the marked stalls outside the building in order to preserve space inside the building. Passenger vehicles could easily be parked within the building, and cars that would fit in a 15 ft space could be placed in a space adjacent to a column. With a valet operation on 2130 East Orangewood Avenue, an additional 55 vehicles could be stacked within the site, for a total parking supply of 239. On-Street Parking On-street parking is allowed along Dupont Drive. Along the project site, both Dupont Drive (west) and Dupont Drive (east) have approximately 235 ft of curb for 10 parallel parking spaces, although planned improvements for Dupont Drive (west) in the Platinum Triangle Implementation Plan (Plan O-3) may require the restriction of on-street parking near the intersection with Orangewood Avenue. Regardless, the City does not consider on-street parking spaces toward meeting the off-street parking requirements of the AMC. MUNICIPAL CODE PARKING REQUIREMENTS The off-street parking requirements found in AMC Section 18.42.040 apply to the proposed project. Table A identifies the parking requirement for the project based on application of the appropriate section of the AMC. The AMC does not identify a parking rate per area for outdoor recreation but does identify a parking rate per area for an indoor recreation use. Based on the density of people playing yard games, this rate appeared reasonable to apply for the proposed project. Table A: Municipal Code Parking Requirements Land Use Parking Space Rates Per Anaheim Municipal Code §18.42.040 Project Parking Requirements Size Unit Required Parking Spaces Alcoholic Beverage Manufacturing 1.55 spaces per TSF, which may include a maximum of 10 percent office space 14.484 TSF 23 Alcoholic Beverage Tasting Room 17 spaces per TSF 0.770 TSF 13 Entertainment Venue 17 spaces per TSF 3.378 TSF 57 Office – General 4 spaces per TSF for buildings 3 stories or below 1.697 TSF 7 Recreation – Commercial Outdoor Requires parking demand study; indoor recreation (skating rink) 2.4 spaces per TSF 8.517 TSF 20 Retail Sales 5.5 spaces per TSF for the first 100 TSF, plus 4.5 spaces per TSF over 100 TSF 0.580 TSF 3 Restaurant – Full Service 15 spaces per TSF 7.054 TSF 106 Restaurant – Outdoor Dining 15 spaces per TSF 1.942 TSF 29 Outdoor Seating –Fast Casual 15 spaces per TSF 4.147 TSF 62 TOTAL 320 TSF = thousand square feet L S A A S S O C I A T E S , I N C .L S A A S S O C I A T E S , I N C .L S A A S S O C I A T E S , I N C .L S A A S S O C I A T E S , I N C . OOOO C T O B E RC T O B E RC T O B E RC T O B E R 2 0 1 62 0 1 62 0 1 62 0 1 6 P A R K I N G S T U D YP A R K I N G S T U D YP A R K I N G S T U D YP A R K I N G S T U D Y G O L D E N R O A D B R E W E R YG O L D E N R O A D B R E W E R YG O L D E N R O A D B R E W E R YG O L D E N R O A D B R E W E R Y C I T Y O F A N A H E I M , C A LC I T Y O F A N A H E I M , C A LC I T Y O F A N A H E I M , C A LC I T Y O F A N A H E I M , C A L I F O R N I AI F O R N I AI F O R N I AI F O R N I A P:\GRB1601\Parking Study4.docx «10/19/16» 9 As Table A shows, application of the AMC would require 320 parking spaces for the project, of which 57 parking spaces are required for the special event venue. The project proposes to provide a maximum of 240 parking spaces during valet operation, which is a 26 percent reduction. PARKING DEMAND Golden Road Brewery has a less labor-intensive operation than other microbreweries. This facility is not serving as the primary production facility for Golden Road Brewery. Instead, this facility is making smaller batches of experimental beer. Its function is testing and reacting to consumer response before a new offering is put into large scale production at the primary Los Angeles plant. In addition, the brewery operations space in the proposed project includes a significant amount of space for storing, aging, and lagering. While it is space being used in the brewing operation, it is not active space occupied by employees. The combined effect is that the AMC rates estimate parking demand for 23 vehicles related to brewing operations, but Golden Road Brewery does not anticipate having more than 8 employees on site for brewing operations. The outdoor seating area for customers of fast-casual food and beverage service will function differently than the outdoor dining patio of the full-service restaurant. Firstly, this area will have lower staffing needs and therefore will require fewer employee parking spaces. All customers will walk up to a service counter for food and beverages. Secondly, full-service restaurants involve a lot of waiting, including waiting to be seated. Customers waiting to be seated are occupying a parking space even before they are occupying a table. The necessity to wait is less within the fast-casual seating area. Thirdly, and most importantly, the density of seating is lower in the outdoor seating area than in the restaurant’s patio. Less seating per square foot will require less parking per square foot. One of the outdoor seating areas will have four 10-seat picnic tables capable of seating a total of 40 people. This is likely to generate demand for 20 parking spaces because pairs of customers are likely to arrive in the same vehicle. The other outdoor seating area will have six 4-seat round tables. These small round tables will either seat one couple that arrive in one car or two couples that made plans to dine together and arrive in either the same car or in two cars. Using an average of 1.5 cars per 4-seat table, the six tables would require 9 parking spaces. It is therefore estimated that the outdoor seating areas will require a total of 29 parking spaces. As is described below, when the walking travel mode is considered, this parking demand is reduced to 26. The special event space within the barrel aging vault contains a main room and one smaller room that could be used instead of the main room. Only one event at a time could be booked within the barrel aging vault. Because use of the main room would have higher parking demand than use of the smaller room, this space is used to determine the maximum parking demand for the barrel aging room. As an entertainment venue, the total area of the barrel room (3,378 sf) would require 57 parking spaces for the 150 fixed seats in the main room. It should be noted that the AMC assembly parking rate of 1 parking space for every 3 fixed seats would result in parking demand for 50 parking spaces for the 150 fixed seats in the barrel aging room. However, the higher estimate of 57 parking spaces has been used. All other uses have traffic generated using AMC rates. However, consideration was given to travel mode. The project site is located in the Platinum Triangle, within walking distance of constructed and planned residential developments. The site can also be reached from Anaheim Resort area hotels via Anaheim Resort Transit or from Anaheim Stadium by walking. Some of Golden Road Brewery’s L S A A S S O C I A T E S , I N C .L S A A S S O C I A T E S , I N C .L S A A S S O C I A T E S , I N C .L S A A S S O C I A T E S , I N C . OOOO C T O B E RC T O B E RC T O B E RC T O B E R 2 0 1 62 0 1 62 0 1 62 0 1 6 P A R K I N G S T U D YP A R K I N G S T U D YP A R K I N G S T U D YP A R K I N G S T U D Y G O L D E N R O A D B R E W E R YG O L D E N R O A D B R E W E R YG O L D E N R O A D B R E W E R YG O L D E N R O A D B R E W E R Y C I T Y O F A N A H E I M , C A LC I T Y O F A N A H E I M , C A LC I T Y O F A N A H E I M , C A LC I T Y O F A N A H E I M , C A L I F O R N I AI F O R N I AI F O R N I AI F O R N I A P:\GRB1601\Parking Study4.docx «10/19/16» 10 patrons will use alternative travel modes and will not require a parking space. In order to determine the appropriate percentage reduction to account for walking, transit, and internal trip capture, LSA examined the approved parking study for Anaheim GardenWalk. The GardenWalk parking study applied a 25 percent reduction to bars/nightclubs (i.e., 10 percent walking, 5 percent transit, and 10 percent internal capture) and a higher percent reduction for other uses. As the Platinum Triangle is built out and more transit options become available near the project site, these parking reductions may be possible for Golden Road Brewery. Given the current transportation environment, LSA applied a 10 percent reduction to the AMC parking rates for commercial uses. The project is providing a convenient drop-off/pick-up area around a branded medallion near the main entrance. Customers using traditional taxis or smartphone based ridesharing services will be able to use this area. But since little data exists to quantify the reduction in parking demand resulting from ridesharing, this parking study conservatively does not take credit for the drop-off/pick-up area. Table B identifies the anticipated parking demand for each of the land uses. Table B: Anticipated Parking Demand Land Use Size Unit AMC Required Parking Travel Mode Adjustments Anticipated Parking Demand Alcoholic Beverage Manufacturing 14.484 TSF 23 Maximum Employees 8 Alcoholic Beverage Tasting Room 0.770 TSF 13 Walk, Transit, and Internal: 10% 12 Entertainment Venue 3.378 TSF 57 Walk, Transit, and Internal: 0% 57 Office – General 1.697 TSF 7 Walk, Transit, and Internal: 0% 7 Recreation – Commercial Outdoor 8.517 TSF 20 Walk, Transit, and Internal: 10% 18 Retail Sales 0.580 TSF 3 Walk, Transit, and Internal: 10% 3 Restaurant – Full Service 7.054 TSF 106 Walk, Transit, and Internal: 10% 95 Restaurant – Outdoor Dining 1.942 TSF 29 Walk, Transit, and Internal: 10% 26 Outdoor Seating –Fast Casual 4.147 TSF 62 Limited by Seating Density 26 Total 252 AMC = Anaheim Municipal Code TSF = thousand square feet LSA further considered that the Golden Road Brewery includes employment land uses (i.e., office space and brewery operations), which are not expected to generate parking demand during the evening hours when the restaurant will generate its peak demand. Time-of-day factors found in the Urban Land Institute’s (ULI) Shared Parking (Second Edition) were applied to the parking demand in Table B. Table C (attached) shows that after consideration of parking reductions to account for actual brewery employees, travel mode, and shared parking methodology to account for variation in parking demand throughout the day, the proposed project would require a maximum of 237 parking spaces for operation during a special event and 180 spaces for operations without a special event. PARKING MANAGEMENT PLAN The analysis presented above estimates peak parking demand for 237 parking spaces during a special event and 180 parking spaces during operations without a special event. The project will provide a total of 184 self-park parking spaces, which would accommodate parking demand on a typical day but could be exceeded during a special event. Specifically, special events occurring before 5:00 p.m. could be accommodated within the 184-space self-park parking supply. Special events occurring after 5:00 p.m. with fewer than 75 attendees could be accommodated within the 184-space self-park L S A A S S O C I A T E S , I N C .L S A A S S O C I A T E S , I N C .L S A A S S O C I A T E S , I N C .L S A A S S O C I A T E S , I N C . OOOO C T O B E RC T O B E RC T O B E RC T O B E R 2 0 1 62 0 1 62 0 1 62 0 1 6 P A R K I N G S T U D YP A R K I N G S T U D YP A R K I N G S T U D YP A R K I N G S T U D Y G O L D E N R O A D B R E W E R YG O L D E N R O A D B R E W E R YG O L D E N R O A D B R E W E R YG O L D E N R O A D B R E W E R Y C I T Y O F A N A H E I M , C A LC I T Y O F A N A H E I M , C A LC I T Y O F A N A H E I M , C A LC I T Y O F A N A H E I M , C A L I F O R N I AI F O R N I AI F O R N I AI F O R N I A P:\GRB1601\Parking Study4.docx «10/19/16» 11 parking supply. Special events occurring after 5:00 p.m. with 75 or more attendees would require additional parking. Additional parking demand for special events occurring after 5:00 p.m. with 75 or more attendees could be accommodated by the use of valet stacking within 2130 East Orangewood Avenue. As mentioned previously, on days planned for a special event requiring valet parking, the driveway on Orangewood Avenue would be signed as an exit-only and all vehicles would be directed to the driveway entrance on Dupont Drive (west). A rolling valet stand would be placed near the entrance to the warehouse to accept customer vehicles. Enough room would be provided from the rolling valet stand to Dupont Drive (west) to allow three vehicles to queue while waiting for a valet. Figure 4 illustrates the location of 164 parking spaces that could be stacked during valet operation. This would bring the total parking supply to 239, which could accommodate peak demand during a special event. The methodology described in Robert Crommelin’s Entrance Exit Design and Control for Major Parking Facilities was used to determine the potential queues that may form at the valet stand. Worksheets related to the Crommelin analysis are included in Appendix B. The highest inbound volume typically expected was compared to the service rate for an information booth with directions needed (14.8 seconds per vehicle for a design capacity of 195 vehicles per hour). The average queue lengths anticipated were calculated based on the Reservoir Needs versus Traffic Intensity chart in the Crommelin report. If half of the 57 vehicles for a special event arrive during the peak 15 minutes, this would equate to a traffic intensity of 0.61. On average, a queue of one vehicle is anticipated. The maximum queue, which would not be exceeded 95 percent of the time, is two vehicles. This queue can be accommodated within the off-street parking area. FINDINGS That the variance, under the conditions imposed, if any, will not cause fewer off-street parking spaces to be provided for the proposed use than the number of such spaces necessary to accommodate all vehicles attributable to such use under the normal and reasonably foreseeable conditions of operation of such use. The analysis presented in this report identified that standard ULI shared-parking methodology forecasts the maximum parking demand to be 237 parking spaces during a special event and 180 parking spaces without a special event. The project will provide 184 self-park parking spaces without a special event and 239 parking spaces with a valet operation. Therefore, the project will not cause fewer off-street parking spaces to be provided for the proposed use than the number of spaces necessary to accommodate all parked vehicles attributable to the project under normal conditions of operation. That the variance, under the conditions imposed, if any, will not increase the demand and competition for parking spaces upon public streets in the immediate vicinity of the proposed use. Parking is permitted on Dupont Drive; however, it is noted in the study that the implementation of a signal at Dupont Drive/Orangewood Avenue may eliminate some of the allotted on-street parking. The project is providing a sufficient number of self-park parking spaces when special events are not being held and a sufficient number of valet parking spaces during special events. In addition, the off-street parking spaces provided by the project will be free, which reduces the L S A A S S O C I A T E S , I N C .L S A A S S O C I A T E S , I N C .L S A A S S O C I A T E S , I N C .L S A A S S O C I A T E S , I N C . OOOO C T O B E RC T O B E RC T O B E RC T O B E R 2 0 1 62 0 1 62 0 1 62 0 1 6 P A R K I N G S T U D YP A R K I N G S T U D YP A R K I N G S T U D YP A R K I N G S T U D Y G O L D E N R O A D B R E W E R YG O L D E N R O A D B R E W E R YG O L D E N R O A D B R E W E R YG O L D E N R O A D B R E W E R Y C I T Y O F A N A H E I M , C A LC I T Y O F A N A H E I M , C A LC I T Y O F A N A H E I M , C A LC I T Y O F A N A H E I M , C A L I F O R N I AI F O R N I AI F O R N I AI F O R N I A P:\GRB1601\Parking Study4.docx «10/19/16» 12 chances that on-street parking would be sought for cost avoidance. Therefore, it is anticipated the project will not increase competition for parking spaces on public streets. That the variance, under the conditions imposed, if any, will not increase the demand and competition for parking spaces upon adjacent property in the immediate vicinity of the proposed use (which property is not expressly provided as parking for such use under an agreement in compliance with subsection .030 of Section 18.42.050 [Non-Residential Uses-Shared Parking Arrangements]). The proposed project includes off-site parking on an adjacent property (2130 East Orangewood Avenue) that is expressly provided as parking for the proposed project. The analysis presented in this report identified that the project will provide sufficient self-park parking spaces on days when a special event is not being held. Special events occurring after 5:00 p.m. with 75 or more attendees would require use of valet parking, which would be located within the project site. Therefore, the proposed project is not anticipated to increase demand and competition for parking spaces on adjacent properties. That the variance, under the conditions imposed, if any, will not increase traffic congestion within the off-street parking areas or lots provided for the proposed use. The analysis presented in this report identified that the project will provide sufficient self-park parking spaces on days when a special event is not being held. Special events occurring after 5:00 p.m. with 75 or more attendees would use valet parking on site. Furthermore, the project site does not contain perpendicular rows and aisles that would be potential sources of congestion. The off- site parking area circulation within the warehouse is one-way, which limits the potential for congestion. Therefore, the proposed project is not expected to increase traffic congestion within the off-street parking areas for the proposed use. That the variance, under the conditions imposed, if any, will not impede vehicular ingress or egress from adjacent properties upon the public streets in the immediate vicinity of the proposed use. The proposed changes to the existing off-street parking areas include the removal of the driveway on Orangewood Avenue and closure of a driveway approximately 50 ft from Orangewood Avenue on Dupont Drive (west). This will eliminate potential sources of conflict with the arterial streets. Additionally, the project’s peak parking demand is anticipated to occur outside the business hours for adjacent properties. Therefore, the parking plan is not anticipated to impede vehicular ingress or egress from adjacent properties upon the public streets. CONCLUSION LSA examined parking at the proposed Golden Road Brewery project. Based on the variable parking demand for each of the site’s uses, a maximum parking demand of 180 parking spaces is anticipated without a special event compared to 184 self-park parking spaces provided. During a special event occurring after 5:00 p.m. with 75 or more attendees, the maximum parking demand is anticipated to be 237 parking spaces, which could be accommodated within the 239 parking spaces available with valet operations. The parking supply will accommodate the anticipated parking demand with the use of the off-site parking lot during normal operation. As a result, this project would satisfy the City’s findings for a parking variance. L S A A S S O C I A T E S , I N C .L S A A S S O C I A T E S , I N C .L S A A S S O C I A T E S , I N C .L S A A S S O C I A T E S , I N C . OOOO C T O B E RC T O B E RC T O B E RC T O B E R 2 0 1 62 0 1 62 0 1 62 0 1 6 P A R K I N G S T U D YP A R K I N G S T U D YP A R K I N G S T U D YP A R K I N G S T U D Y G O L D E N R O A D B R E W E R YG O L D E N R O A D B R E W E R YG O L D E N R O A D B R E W E R YG O L D E N R O A D B R E W E R Y C I T Y O F A N A H E I M , C A LC I T Y O F A N A H E I M , C A LC I T Y O F A N A H E I M , C A LC I T Y O F A N A H E I M , C A L I F O R N I AI F O R N I AI F O R N I AI F O R N I A P:\GRB1601\Parking Study4.docx «10/19/16» APPENDIX A SHARED PARKING TABLE LS A A S S O C I A T E S , I N C . Go l d e n R o a d B r e w e r y P a r k i n g C a l c u l a t i o n s Pa r k i n g R a t e s La n d U s e Re t a i l S a l e s - G e n e r a l Re s t a u r a n t - F u l l S e r v i c e Alc o h o l i c B e v e r a g e M a n u f a c t u r i n g Alc o h o l i c B e v e r a g e - T a s t i n g R o o m Re c r e a t i o n - S k a t i n g R i n k s En t e r t a i n m e n t V e n u e Of f i c e - G e n e r a l In d i v i d u a l U s e P a r k i n g R e q u i r e m e n t s Si z e U n i t AM C R e q u i r e d Pa r k i n g Re t a i l ( R e t a i l S a l e s - G e n e r a l ) 0. 5 8 0 T S F 3 10 % Re s t a u r a n t ( R e s t a u r a n t - F u l l S e r v i c e ) 7. 0 5 4 T S F 1 0 6 10 % Ou t d o o r D i n i n g ( R e s t a u r a n t - F u l l S e r v i c e ) 1. 9 4 2 T S F 2 9 10 % Ta s t i n g R o o m ( A l c o h o l i c B e v e r a g e - T a s t i n g R o o m ) 0. 7 7 0 T S F 1 3 10 % Br e w e r y O p e r a t i o n s ( A l c o h o l i c B e v e r a g e M a n u f a c t u r i n g ) 1 14 . 4 8 4 T S F 2 2 . 5 0% Ac t u a l B r e w e r y S t a f f 7 Of f i c e ( O f f i c e - G e n e r a l ) 2 1. 6 9 7 T S F 7 0% Sp e c i a l E v e n t ( E n t e r t a i n m e n t V e n u e ) 3. 3 7 8 T S F 5 7 0% Ou t d o o r S e a t i n g ( R e s t a u r a n t - F u l l S e r v i c e ) 4. 1 4 7 T S F 6 2 10 % Ou t d o o r R e c r e a t i o n ( R e c r e a t i o n ) 3 8. 5 1 7 T S F 2 0 10 % To t a l 32 0 DU = D w e l l i n g U n i t TS F = T h o u s a n d S q u a r e F e e t 1 B r e w e r y O p e r a t i o n s ( 1 2 , 9 6 6 s f ) + g r o u n d f l o o r o f f i c e ( 2 , 2 1 5 s f ) = 1 5 , 1 8 1 s f o f w h i c h 1 0 p e r c e n t ( 1 , 5 1 8 s f ) i s o f f i c e a t t h e m a n u f a c t u r i n g r a t e fo r a t o t a l o f 1 4 , 4 8 4 s f a t t h e m a n u f a c t u r i n g r a t e a n d 6 9 7 s f o f g r o u n d f l o o r o f f i c e r e m a i n i n g . 2 R e m a i n i n g g r o u n d f l o o r o f f i c e ( 6 9 7 s f ) + s e c o n d f l o o r o f f i c e ( 1 , 0 0 0 s f ) = 1 , 6 9 7 s f 3 R e c r e a t i o n i n c l u d e s h a m m o c k g r o v e , b o c c e , y a r d g a m e a r e a , r e c r e a t i o n a r e a s , s t a g e , f e a t u r e g o l f s i m u l a t o r , p e t a r e a , a n d k i d - f r i e n d l y p l a y a r e a . Ta b l e C : W e e k d a y T i m e o f D a y w i t h R e d u c e d P a r k i n g f o r T r a v e l M o d e 6: 0 0 a . m . 7 : 0 0 a . m . 8 : 0 0 a . m . 9 : 0 0 a . m . 1 0 : 0 0 a . m . 1 1 : 0 0 a . m . 1 2 : 0 0 p . m . 1 : 0 0 p . m . 2 : 0 0 p . m . 3 : 0 0 p . m . 4 : 0 0 p . m . 5 : 0 0 p . m . 6 : 0 0 p . m . 7 : 0 0 p . m . 8 : 0 0 p . m . 9 : 0 0 p . m . 1 0 : 0 0 p . m . 1 1 : 0 0 p . m . Ma n u f a c t u r i n g ( O f f i c e ) Vi s i t o r 1% 2 0 % 6 0 % 1 0 0 % 4 5 % 1 5 % 4 5 % 1 0 0 % 4 5 % 1 5 % 1 0 % 5 % 2 % 1 % Em p l o y e e 3% 3 0 % 7 5 % 9 5 % 1 0 0 % 1 0 0 % 9 0 % 9 0 % 1 0 0 % 1 0 0 % 9 0 % 5 0 % 2 5 % 1 0 % 7 % 3 % 1 % Re t a i l S a l e s ( S h o p p i n g C e n t e r ) C u s t o m e r 1 % 5 % 1 5 % 3 5 % 6 5 % 8 5 % 9 5 % 1 0 0 % 9 5 % 9 0 % 9 0 % 9 5 % 9 5 % 9 5 % 8 0 % 5 0 % 3 0 % 1 0 % Em p l o y e e 1 0 % 1 5 % 4 0 % 7 5 % 8 5 % 9 5 % 1 0 0 % 1 0 0 % 1 0 0 % 1 0 0 % 1 0 0 % 9 5 % 9 5 % 9 5 % 9 0 % 7 5 % 4 0 % 1 5 % Ta s t i n g R o o m , P a t i o , a n d R e s t a u r a n t Cu s t o m e r 15 % 4 0 % 7 5 % 7 5 % 6 5 % 4 0 % 5 0 % 7 5 % 9 5 % 1 0 0 % 1 0 0 % 1 0 0 % 9 5 % 7 5 % ( F i n e / C a s u a l D i n i n g ) Em p l o y e e 20 % 5 0 % 7 5 % 9 0 % 9 0 % 9 0 % 9 0 % 9 0 % 7 5 % 7 5 % 1 0 0 % 1 0 0 % 1 0 0 % 1 0 0 % 1 0 0 % 1 0 0 % 8 5 % Re c r e a t i o n ( C i n e p l e x ) Cu s t o m e r 20 % 4 5 % 5 5 % 5 5 % 5 5 % 6 0 % 6 0 % 8 0 % 1 0 0 % 1 0 0 % 8 0 % 6 5 % En t e r t a i n m e n t V e n u e ( C o n f e r e n c e / B a n q u e t ) Gu e s t 0 % 0 % 3 0 % 6 0 % 6 0 % 6 0 % 6 5 % 6 5 % 6 5 % 6 5 % 6 5 % 1 0 0 % 1 0 0 % 1 0 0 % 1 0 0 % 1 0 0 % 5 0 % 0 % To t a l D e m a n d Br e w e r y O p e r a t i o n s 8 0 2 6 8 8 8 7 7 8 8 7 4 2 1 1 0 0 0 Of f i c e 7 0 2 5 6 7 6 6 6 7 6 6 3 2 1 0 0 0 0 Re t a i l 3 0 0 1 1 2 2 2 3 2 2 2 2 2 2 2 1 1 0 Ta s t i n g R o o m 12 0 0 1 1 3 6 9 9 8 5 6 9 1 1 1 2 1 2 1 2 1 1 9 Re c r e a t i o n 18 0 0 0 0 0 0 4 8 1 0 1 0 1 0 1 1 1 1 1 5 1 8 1 8 1 5 1 2 Re s t a u r a n t , O u t d o o r D i n i n g , a n d O u t d o o r S e a t i n g 1 4 7 0 4 11 17 3 9 7 0 1 1 4 1 1 4 1 0 1 6 7 7 9 1 1 6 1 4 1 1 4 7 1 4 7 1 4 7 1 4 1 1 1 3 En t e r t a i n m e n t V e n u e 57 0 0 17 34 34 34 37 37 37 37 37 57 57 57 57 57 29 0 To t a l 0 9 40 67 93 12 6 17 9 18 4 17 4 13 6 14 8 20 3 22 6 23 5 237 236 197 134 1 T i m e - o f - D a y F a c t o r s r e f e r e n c e d f r o m Sh a r e d P a r k i n g , S e c o n d E d i t i o n , U r b a n L a n d I n s t i t u t e , 2 0 0 5 ( f o r t h e l a n d u s e s n a m e d w i t h i n p a r a n t h e s e s ) . Tr a v e l M o d e A d j u s t m e n t s Wa l k , T r a n s i t , a n d I n t e r n a l : 1 0 % Wa l k , T r a n s i t , a n d I n t e r n a l : 1 0 % Ma x i m u m E m p l o y e e s Wa l k , T r a n s i t , a n d I n t e r n a l : 0 % Wa l k , T r a n s i t , a n d I n t e r n a l : 1 0 % Wa l k , T r a n s i t , a n d I n t e r n a l : 1 0 % 8 Tim e o f D a y F a c t o r s 1 Tim e o f D a y P a r k i n g D e m a n d Go l d e n R o a d B r e w e r y S h a r e d P a r k i n g R e q u i r e m e n t s Wa l k , T r a n s i t , a n d I n t e r n a l : 0 % 7 57 26 18 25 2 Mu n i c i p a l C o d e 5.5 s p a c e s p e r T S F f o r t h e f i r s t 1 0 0 T S F p l u s 4 . 5 s p a c e s p e r T S F o v e r 1 0 0 T S F 17 s p a c e s p e r T S F 4 s p a c e s p e r T S F f o r b u i l d i n g s t h r e e s t o r i e s o r b e l o w , 3 s p a c e s p e r T S F f o r b u i l d i n g s f o u r s t o r i e s o r h i g h e r Wa l k , T r a n s i t , a n d I n t e r n a l : 1 0 % Lim i t e d b y d e n s i t y o f s e a t i n g An t i c i p a t e d P a r k i n g De m a n d 3 95 26 12 15 s p a c e s p e r T S F 1.5 5 s p a c e s p e r T S F , w h i c h m a y i n c l u d e a m a x i m u m o f 1 0 p e r c e n t o f f i c e s p a c e 17 s p a c e s p e r T S F 2. 4 s p a c e s p e r T S F P:\ G R B 1 6 0 1 \ S h a r e d P a r k i n g 6 . x l s x \ A M C w i t h R e d u c t i o n s ( 1 0 / 1 9 / 2 0 1 6 ) 1" = 30'-0" SITE PLAN Date: Job No: Sheet No: A Drawing: Drawn By: Checked By: GOLDEN ROAD BREWING 2210 E. ORANGEWOOD AVE. ANAHEIM, CA 92806 16034 19-OCT-2016 - - ARCHITECTURAL SITE PLAN A1.01 KEYNOTES 1.PROPOSED CAN SHOP. 2.(E) ASPHALT PARKING LOT TO BE RENOVATED PER CIVIL. 3.OUTDOOR DINING / GATHERING AREA. 4.OUTDOOR BAR. 5.OUTDOOR GAMES AREA. Table A: Golden Road Brewery Parking Parking Rates Land Use Municipal Code Retail Sales - General 5.5 spaces per TSF Restaurant - Full Service 15 spaces per TSF Alcoholic Beverage Manufacturing 1.55 spaces per TSF, which may include a maximum of 10 percent office space Alcoholic Beverage - Tasting Room 17 spaces per TSF Recreation - Skating Rinks 2.4 spaces per TSF Entertainment Venue 17 spaces per TSF Office - General 4 spaces per TSF Individual Use Parking Requirements Size Unit AMC Required Parking Retail Sales - Can Shop 0.507 TSF 3 Restaurant - Full Service 7.054 TSF 106 Outdoor Dining 1.942 TSF 29 Brewery Tasting Room 0.770 TSF 13 Brewery Operations 12.966 TSF 20 Brewery Office 1.518 TSF 2 Office - General 1.697 TSF 7 Special Event Area 3.378 TSF 57 Outdoor Seating - Fast Casual 4.147 TSF 62 Outdoor Recreation 8.517 TSF 20 Total 320 DU = Dwelling Unit TSF = Thousand Square Feet Shared Parking Study Parking Demand 237 Shared Parking Study Percent Reduction 26% On-Site Parking 75 Off-Site Parking (with valet)164 Total Parking Supply 239 2 REV. 2 10/19/2016 STAGE MAIN KITCHEN 109 BARREL VAULT 114PREP KITCHEN 131 BREWERY 136 FEATURE 144 COLD BOX 141 BREWER'S OFFICE 140 PACKAGING 137 STREET 106 DINING ROOM 101 MEN 103 WOMEN 102 VIP ROOM 117 TANK BAR 105 CAN SHOP 150 RR 115 RR 116 STAIR 1 OFFICE 127 OFFICE 126 OFFICE 125 OFFICE 124 OFFICE 119 OFFICE 122 MEDIA 123 BREAK 120 DRAFT COLD BOX 113 RR 130 RR 129 ELECTRICAL 143 EXPO 107 BUS 108 COOLER 110 DISH 111 OFFICE 112 IT 118STAFF 128 DISH 135 DRY STOR. 134 FREEZER 133 COOLER 132 STORAGE 138 MCC 139 SHIPPING 142 ROASTER 104 OUTDOOR DINING 01 BOCCE AND FAMILY ROOM 02 HAMMOCK GROVE 03 OUTDOOR GAMING AREA 04 BEACH FIRE PIT 05 OUTDOOR RECREATIONAL SPACE 06 ELEVATED STAGE 07 KID SAFE PLAY AREA 08 DOG RUN 09 STORMWATER TREATMENT AREA 010 OUTDOOR STORAGE 011 TRASH AND RECYCLING COLLECTION 012 BOILER AND CHILLER 014 TOOL SHED 015 TOOL SHED 015 TOOL SHED 015 DROP-OFF AND PICK UP 013 X X X X X CAN SHOP 150 19'-8" 15 ' - 8 1 / 2 " RETAIL: SLAB ON GRADE WITH EPOXY PAINT, METAL FRAMED INSULATED WALLS/CEILINGS. UNCONDITIONED CORRUGATED METAL SILO SPACE AT REACH IN COOLERS RETAIL WARMING UNITS POS REACH IN COOLERS 150A 15 0 B R13'-0 " 3'-2" 1/16" = 1'-0" FIRST FLOOR PLAN - OVERALL 1/8" = 1'-0" ENLARGED PLAN - CAN SHOP - OPTION 1 Date: Job No: Sheet No: A Drawing: Drawn By: Checked By: GOLDEN ROAD BREWING 2210 E. ORANGEWOOD AVE. ANAHEIM, CA 92806 16034 19-OCT-2016 - - FIRST FLOOR PLAN - OVERALL A2.11 2 A2.11 2 A3.01 3 A3.01 1 A3.01 4 A3.01 1 A3.02 2 A3.02 1.(E) RESTROOM TO REMAIN. 2.FUTURE SHADE TRELLIS: PROVIDE ROUGH-INS FOR GAS, ELECTRICAL, AND WATER. 3.NEW ALUMINUM AND GLASS OVERHEAD DOOR. 4.NEW HORIZONTAL FOLDING ALUMINUM AND GLASS DOOR. 5.NEW ALUMINUM STOREFRONT AND ENTRANCE WHERE SHOWN. 6.LAMINATED BAR TOP WITH METAL-FRAMED DIE-WALL WITH WOOD FINISH AND FOOT RAIL. ASSUME ROUGH-INS FOR EQUIPMENT UNDER BAR. 7.CONCRETE BAR TOP WITH BREEZE BLOCK DIE-WALL. 8.WOOD FRAMED "TOOL SHED" WITH FOLDING, LOCKING DOORS ON OVERHEAD TRACK. INTERIOR: PAINTED CONCRETE WALL (EXISTING) WITH TVs, BEER TAPS, WARE WASHING, REFRIGERATOR, GLASS RACKS AND STORAGE. 9.CHANNEL GLASS WALL. 10.COFFEE ROASTER WITH GAS CONNECTION AND FLUE. 11.WOOD FRAMED ENTRY PORTAL (SIMILAR TO "TOOL SHEDS") WITH SIGNAGE SUPPORT. SEE ELEVATIONS. 12.INFILL EXISTING ARCHES WITH CONCRETE TO MATCH EXISTING WALL. 13.NEW METAL STUD WALL WITH GYPSUM BOARD. 14.SERVING TANKS BY OWNER. PROVIDE THICKENED SLAB AND TRENCH DRAIN. 15.NOT USED. 16.FEATURE BY OTHERS. PROVIDE ELECTRICAL CONNECTION. 17.BREWING/PACKAGING EQUIPMENT BY OTHERS. PROVIDE THICKENED SLAB AND TRENCH DRAINS. 18.NOT USED. 19.NEW GALVANIZED STEEL STAIR. 20.42" HIGH PAINTED STEEL SAFETY GUARDRAIL. 21.BARRELS, SEATING, MOBILE BAR, MOBILE STAGE BY OTHERS. 22.NEW LOUVER IN EXISTING OPENING. 23.NEW BUILT-IN-PLACE REFRIGERATED UNIT WITH REMOTE COMP. AND OVERHEAD DOORS. 24.NEW DISPLAY WALL WITH DIRECT-DRAW BEER TAPS AND UNDER COUNTED EQUIPMENT. 25.CASEWORK. 26.WOOD DECK OR GREEN ROOF ON MEMBRANE ROOFING ON CANTILEVERED FRAMING ON "TOOL SHED" STRUCTURE BELOW. 2 2 2 1 1 33 3 44 4 5 6 6 6 7 7 7 8 8 8 9 10 11 11 12 13 TYP 13 TYP 13 TYP 14 TYP 16 17 19 20 20 21 23 23 3 A4.01 3 A4.01 2 A4.01 2 A4.01 1 A4.01 1 A4.01 2 10/19/2016REV. 2 L S A A S S O C I A T E S , I N C .L S A A S S O C I A T E S , I N C .L S A A S S O C I A T E S , I N C .L S A A S S O C I A T E S , I N C . OOOO C T O B E RC T O B E RC T O B E RC T O B E R 2 0 1 62 0 1 62 0 1 62 0 1 6 P A R K I N G S T U D YP A R K I N G S T U D YP A R K I N G S T U D YP A R K I N G S T U D Y G O L D E N R O A D B R E W E R YG O L D E N R O A D B R E W E R YG O L D E N R O A D B R E W E R YG O L D E N R O A D B R E W E R Y C I T Y O F A N A H E I M , C A LC I T Y O F A N A H E I M , C A LC I T Y O F A N A H E I M , C A LC I T Y O F A N A H E I M , C A L I F O R N I AI F O R N I AI F O R N I AI F O R N I A P:\GRB1601\Parking Study4.docx «10/19/16» APPENDIX B GATE STACKING ANALYSIS 10/19/16 «P:\GRB1601\Trip Gen Memo\Trip Generation5.docx» L S A A S S OC IA T ES , INC . 20 EXECUTIVE PARK, SUITE 200 IRVINE, CALIFORNIA 92614 949.553.0666 TEL 949.553.8076 FAX BERKELEY CARLSBAD FRESNO PALM SPRINGS PT. RICHMOND RIVERSIDE ROCKLIN SAN LUIS OBISPO PLANNING | ENVIRONMENTAL SCIENCES | DESIGN October 19, 2016 Brandon Smith Golden Road Brewery 5430 West San Fernando Road Los Angeles, California 90039 Subject: Golden Road Brewery, Anaheim – Trip Generation Analysis Dear Mr. Smith: At your request, LSA Associates, Inc. (LSA) has prepared this analysis of trip generation for the proposed reconfiguration of Golden Road Brewery (project) at 2210 East Orangewood Avenue in the City of Anaheim (City). The purpose of this analysis is to determine the trip generation of the proposed project and whether the project would require a more detailed traffic analysis according to the City’s Criteria for Preparation of Traffic Impact Studies. To that end, trip generation comparisons are made in the existing and General Plan Buildout scenarios. The City’s Criteria for Preparation of Traffic Impact Studies states that a traffic impact analysis (TIA) would be needed for a project that generates 100 or more a.m. or p.m. peak-hour trips, would contribute 51 or more peak-hour trips to any Congestion Management Program (CMP) monitored intersection, would generate 1,600 daily trips if located on the CMP highway system, or would generate 2,400 daily trips if adjacent to the CMP highway system. The Orange County CMP highway system does not include Orangewood Avenue. Golden Road Brewery is located within the Orangewood District in the Platinum Triangle. The City has planned the Platinum Triangle to be a vibrant mixed-use neighborhood and a new downtown for Orange County. When completed, the Platinum Triangle will be home to 28,000 residential units. Residential development is occurring in the immediate vicinity of Golden Road Brewery. On March 5, 2016, the final phase of the Gateway Apartments opened. The George Apartments are under construction immediately across the street. The Platinum Center project proposes 255 apartments as part of its first phase. All of these residences will be within a 5-minute walk of Golden Road Brewery. In Fall 2015, Golden Road Brewery completed the purchase of two adjacent buildings (2210 East Orangewood Avenue and 2220 East Orangewood Avenue) and received authorization to commence brewing operations and open a tasting room. The buildings had a combined total of 57,000 square feet (sf) of space, of which 7,473 sf was partitioned for office space. The project proposes renovations including the demolition of 2220 East Orangewood Avenue. Interior renovations of the remaining building would provide a restaurant, a tank bar/tasting room, brewing operations, and an office. Outdoor space created by the demolition of 2220 East Orangewood Avenue would provide outdoor dining for the full-service restaurant, recreational space, and some seating area for walk-up food and beverage service. ATTACHMENT NO. 6 10/19/16 «P:\GRB1601\Trip Gen Memo\Trip Generation5.docx» 2 L S A A S S OC IA T ES , INC .L S A A S S OC IA T ES , INC .L S A A S S OC IA T ES , INC .L S A A S S OC IA T ES , INC . Trip Generation The trip generation potential of the proposed project was calculated using trip generation rates found in the Institute of Transportation Engineers (ITE) Trip Generation, Ninth Edition (2012). A conservatively high estimate of trip-generation rate is being used by not applying a reduction to account for the potential for non-vehicular mode share. As previously mentioned, many residential developments are located within a 5-minute walk of Golden Road Brewery. The surrounding industrial neighborhood also has the potential to reduce new automobile trips generated as walking trips. Not all of the trips generated by the project will be new to Orangewood Avenue because some customers will stop at the proposed project as part of a trip chain between work and home (i.e., pass-by trips), from the industrial neighborhood to home or from a workplace to a residential development in the Platinum Triangle. The ITE Trip Generation Handbook, Second Edition (2004) provides surveyed pass-by rates for a selection of land uses and states that, on average, 43 percent of the traffic to a restaurant is part of a trip chain from the adjacent street. The Platinum Triangle Master Land Use Plan anticipated 1,450 residential dwelling units, 812,855 sf of office space, and 120,000 sf of commercial space on the properties surrounding Dupont Drive, providing further future opportunity for non-vehicular trips and trip chains. Table A (all tables provided in Attachment A) presents the trip-generation estimate for the proposed project. It should be noted that 6,443 sf of the total 8,517 sf of recreational space (including a proposed indoor golf simulator, sand play area, pet relief area, hammocks, and bocce courts) is anticipated to extend the stay of visitors attracted to the food and beverage uses of the proposed project, but that space is not anticipated to draw many of its own unique visitors. Therefore, the trip generation potential of that 6,443 sf is calculated at a recreation trip rate published by ITE. The remaining 2,074 sf of recreation space is a large area with yard games that may or may not function as its own attraction. In order to present a conservative comparison between project trip generation and the established threshold, LSA used the higher trip generation rate for a drinking place within this area. While ITE trip generation rates for high-turnover restaurants are high in the a.m. peak hour, the proposed restaurant is not anticipated to attract as many customers in the a.m. peak hour as a traditional breakfast restaurant. Therefore, the ITE trip generation rate was reduced by 50 percent to account for employee trips and reduced customer trips. As Table A shows, the proposed project is estimated to generate 1,361 daily trips, 60 of which would occur in the a.m. peak hour and 144 of which would occur in the p.m. peak hour. Table A (Attachment A) also presents a comparison of the trip generation potential of the existing buildings using the same ITE methodology. As shown in Table A, 57,000 sf of light industrial space would be estimated to generate 397 daily trips, 52 of which would occur in the a.m. peak hour and 56 of which would occur in the p.m. peak hour. Therefore, the net project trip generation is 964 daily trips, of which 8 would occur in the a.m. peak hour and 88 of which would occur in the p.m. peak hour. The trip generation potential of the proposed project is higher than for the existing buildings, but the net increase is less than 100 trips in the a.m. and p.m. peak hours, which is below the threshold for requiring a TIA. General Plan Trip Generation The project site is one of three parcels within the Anaheim Transportation Analysis Model (ATAM) traffic analysis zone (TAZ) 2639. Within this zone, ATAM analyzes 10,000 sf of community commercial space and 190,000 sf of high-density office space. Table B (Attachment A) presents the trip generation estimate for these land use intensities. Because the project site is about 66 percent of the total L S A A S S O C I A T E S , I N C .L S A A S S O C I A T E S , I N C .L S A A S S O C I A T E S , I N C .L S A A S S O C I A T E S , I N C . O C T O B E RO C T O B E RO C T O B E RO C T O B E R 2 0 1 62 0 1 62 0 1 62 0 1 6 T R I P G E N E R A T I O N A N A LT R I P G E N E R A T I O N A N A LT R I P G E N E R A T I O N A N A LT R I P G E N E R A T I O N A N A L Y S I SY S I SY S I SY S I S G O L D E N R O A D B R E W E R YG O L D E N R O A D B R E W E R YG O L D E N R O A D B R E W E R YG O L D E N R O A D B R E W E R Y C I T Y O F A N A H E I M , C A LC I T Y O F A N A H E I M , C A LC I T Y O F A N A H E I M , C A LC I T Y O F A N A H E I M , C A L I F O R N I AI F O R N I AI F O R N I AI F O R N I A P:\GRB1601\Trip Gen Memo\Trip Generation5.docx «10/19/16» ATTACHMENT A TABLES A AND B Table A: Existing Condition Trip Generation Comparison Land Use Size Unit ADT AM Peak Hour PM Peak Hour In Out Total In Out Total Trip Rates1 General Light Industrial (110) TSF 6.97 0.81 0.11 0.92 0.12 0.85 0.97 Single Tenant Office Building (715) TSF 11.65 1.60 0.20 1.80 0.26 1.48 1.74 Specialty Retail Center (826) TSF 44.32 0.00 0.00 0.00 1.19 1.52 2.71 Drinking Place (925) TSF 56.72 0.00 0.00 0.00 7.48 3.86 11.34 Quality Restaurant (931) TSF 89.95 0.45 0.36 0.81 5.02 2.47 7.49 High-Turnover (Sit-Down) Restaurant (932) TSF 127.15 2.97 2.43 5.413 5.91 3.94 9.85 Trip Generation Proposed Project Can Shop (826) 0.580 TSF 26 0 0 0 1 1 2 Restaurant (932) 13.143 TSF 1,671 39 32 71 78 52 130 Tank Bar/Tasting Room (925) 0.770 TSF 44 0 0 0 6 3 9 Brewery Operations (110) 14.484 TSF 101 12 2 14 2 12 14 Barrel Room (110) 3.378 TSF 24 3 0 3 0 3 3 Office (715) 1.697 TSF 20 3 0 3 0 3 3 Recreation (465) 6.443 TSF 76 0 0 0 7 8 15 Recreation – Game Area (925) 2.074 TSF 118 0 0 0 16 8 24 Subtotal 42.496 TSF 2,080 57 34 91 110 90 200 Pass-by4 (719) (17) (14) (31) (34) (22) (56) New Trip Generation 1,361 40 20 60 76 68 144 Existing Use Light Industrial 57.000 TSF 397 46 6 52 7 49 56 Net Trip Generation 964 (6) 14 8 69 19 88 1 Trip rates are referenced from the Institute of Transportation Engineers Trip Generation Manual, Ninth Edition (2012). 2 Daily rates estimated at five times the p.m. peak hour. 3 Trip rates reduced by 50 percent to account for employee trips and fewer customer trips than would occur at a traditional breakfast restaurant. 4 43 percent pass-by reduction for restaurant use (932) referenced from Institute of Transportation Engineers Trip Generation Handbook, Second Edition (2004). ADT = average daily trips TSF = total square feet L S A A S S O C I A T E S , I N C .L S A A S S O C I A T E S , I N C .L S A A S S O C I A T E S , I N C .L S A A S S O C I A T E S , I N C . O C T O B E RO C T O B E RO C T O B E RO C T O B E R 2 0 1 62 0 1 62 0 1 62 0 1 6 T R I P G E N E R A T I O N A N A LT R I P G E N E R A T I O N A N A LT R I P G E N E R A T I O N A N A LT R I P G E N E R A T I O N A N A L Y S I SY S I SY S I SY S I S G O L D E N R O A D B R E W E R YG O L D E N R O A D B R E W E R YG O L D E N R O A D B R E W E R YG O L D E N R O A D B R E W E R Y C I T Y O F A N A H E I M , C A LC I T Y O F A N A H E I M , C A LC I T Y O F A N A H E I M , C A LC I T Y O F A N A H E I M , C A L I F O R N I AI F O R N I AI F O R N I AI F O R N I A P:\GRB1601\Trip Gen Memo\Trip Generation5.docx «10/19/16» Table B: General Plan Condition Trip Generation Comparison Land Use Size Unit ADT AM Peak Hour PM Peak Hour In Out Total In Out Total Trip Rates1 General Light Industrial (110) TSF 6.97 0.81 0.11 0.92 0.12 0.85 0.97 General Office (710) TSF 11.03 1.37 0.19 1.56 0.25 1.24 1.49 Single Tenant Office Building (715) TSF 11.65 1.60 0.20 1.80 0.26 1.48 1.74 Shopping Center (820) TSF 42.70 0.60 0.36 0.96 1.78 1.93 3.71 Specialty Retail Center (826) TSF 44.32 0.00 0.00 0.00 1.19 1.52 2.71 Drinking Place (925) TSF 56.72 0.00 0.00 0.00 7.48 3.86 11.34 Quality Restaurant (931) TSF 89.95 0.45 0.36 0.81 5.02 2.47 7.49 High-Turnover (Sit-Down) Restaurant (932) TSF 127.15 2.97 2.43 5.413 5.91 3.94 9.85 Trip Generation General Plan Land Use Community Commercial (820) 10 TSF 427 6 4 10 18 19 37 High Density Office (710) 190 TSF 2,096 261 36 296 48 235 283 Total 2,523 267 39 306 66 254 320 Project Site (66 percent of total) 1,665 176 26 202 44 168 212 Proposed Project Can Shop (826) 0.580 TSF 26 0 0 0 1 1 2 Restaurant (932) 13.143 TSF 1,671 39 32 71 78 52 130 Tank Bar/Tasting Room (925) 0.770 TSF 44 0 0 0 6 3 9 Brewery Operations (110) 14.484 TSF 101 12 2 14 2 12 14 Barrel Room (110) 3.378 TSF 24 3 0 3 0 3 3 Office (715) 1.697 TSF 20 3 0 3 0 3 3 Recreation (465) 6.443 TSF 76 0 0 0 7 8 15 Recreation – Game Area (925) 2.074 TSF 118 0 0 0 16 8 24 Subtotal 42.496 TSF 2,080 57 34 91 110 90 200 Pass-by4 (719) (17) (14) (31) (34) (22) (56) New Trip Generation 1,361 40 20 60 76 68 144 Net Trip Generation (304) (136) (6) (142) 32 (100) (68) 1 Trip rates referenced from the Institute of Transportation Engineers Trip Generation Manual, Ninth Edition. 2 Daily rates estimated at five times p.m. peak hour. 3 Trip rates reduced by 50 percent to account for employee trips and fewer customer trips than would occur at a traditional breakfast restaurant. 4 43 percent pass-by reduction for restaurant use (932) referenced from Institute of Transportation Engineers Trip Generation Handbook, Second Edition (2004). ADT = average daily trips TSF = total square feet L S A A S S O C I A T E S , I N C .L S A A S S O C I A T E S , I N C .L S A A S S O C I A T E S , I N C .L S A A S S O C I A T E S , I N C . O C T O B E RO C T O B E RO C T O B E RO C T O B E R 2 0 1 62 0 1 62 0 1 62 0 1 6 T R I P G E N E R A T I O N A N A LT R I P G E N E R A T I O N A N A LT R I P G E N E R A T I O N A N A LT R I P G E N E R A T I O N A N A L Y S I SY S I SY S I SY S I S G O L D E N R O A D B R E W E R YG O L D E N R O A D B R E W E R YG O L D E N R O A D B R E W E R YG O L D E N R O A D B R E W E R Y C I T Y O F A N A H E I M , C A LC I T Y O F A N A H E I M , C A LC I T Y O F A N A H E I M , C A LC I T Y O F A N A H E I M , C A L I F O R N I AI F O R N I AI F O R N I AI F O R N I A P:\GRB1601\Trip Gen Memo\Trip Generation5.docx «10/19/16» ATTACHMENT B ITE RESTAURANT PASS-BY SURVEY DATA L S A A S S O C I A T E S , I N C .L S A A S S O C I A T E S , I N C .L S A A S S O C I A T E S , I N C .L S A A S S O C I A T E S , I N C . O C T O B E RO C T O B E RO C T O B E RO C T O B E R 2 0 1 62 0 1 62 0 1 62 0 1 6 T R I P G E N E R A T I O N A N A LT R I P G E N E R A T I O N A N A LT R I P G E N E R A T I O N A N A LT R I P G E N E R A T I O N A N A L Y S I SY S I SY S I SY S I S G O L D E N R O A D B R E W E R YG O L D E N R O A D B R E W E R YG O L D E N R O A D B R E W E R YG O L D E N R O A D B R E W E R Y C I T Y O F A N A H E I M , C A LC I T Y O F A N A H E I M , C A LC I T Y O F A N A H E I M , C A LC I T Y O F A N A H E I M , C A L I F O R N I AI F O R N I AI F O R N I AI F O R N I A P:\GRB1601\Trip Gen Memo\Trip Generation5.docx «10/19/16» ATTACHMENT C SITE PLAN 1" = 30'-0" SITE PLAN Date: Job No: Sheet No: A Drawing: Drawn By: Checked By: GOLDEN ROAD BREWING 2210 E. ORANGEWOOD AVE. ANAHEIM, CA 92806 16034 19-OCT-2016 - - ARCHITECTURAL SITE PLAN A1.01 KEYNOTES 1.PROPOSED CAN SHOP. 2.(E) ASPHALT PARKING LOT TO BE RENOVATED PER CIVIL. 3.OUTDOOR DINING / GATHERING AREA. 4.OUTDOOR BAR. 5.OUTDOOR GAMES AREA. Table A: Golden Road Brewery Parking Parking Rates Land Use Municipal Code Retail Sales - General 5.5 spaces per TSF Restaurant - Full Service 15 spaces per TSF Alcoholic Beverage Manufacturing 1.55 spaces per TSF, which may include a maximum of 10 percent office space Alcoholic Beverage - Tasting Room 17 spaces per TSF Recreation - Skating Rinks 2.4 spaces per TSF Entertainment Venue 17 spaces per TSF Office - General 4 spaces per TSF Individual Use Parking Requirements Size Unit AMC Required Parking Retail Sales - Can Shop 0.507 TSF 3 Restaurant - Full Service 7.054 TSF 106 Outdoor Dining 1.942 TSF 29 Brewery Tasting Room 0.770 TSF 13 Brewery Operations 12.966 TSF 20 Brewery Office 1.518 TSF 2 Office - General 1.697 TSF 7 Special Event Area 3.378 TSF 57 Outdoor Seating - Fast Casual 4.147 TSF 62 Outdoor Recreation 8.517 TSF 20 Total 320 DU = Dwelling Unit TSF = Thousand Square Feet Shared Parking Study Parking Demand 237 Shared Parking Study Percent Reduction 26% On-Site Parking 75 Off-Site Parking (with valet)164 Total Parking Supply 239 2 REV. 2 10/19/2016 STAGE MAIN KITCHEN 109 BARREL VAULT 114PREP KITCHEN 131 BREWERY 136 FEATURE 144 COLD BOX 141 BREWER'S OFFICE 140 PACKAGING 137 STREET 106 DINING ROOM 101 MEN 103 WOMEN 102 VIP ROOM 117 TANK BAR 105 CAN SHOP 150 RR 115 RR 116 STAIR 1 OFFICE 127 OFFICE 126 OFFICE 125 OFFICE 124 OFFICE 119 OFFICE 122 MEDIA 123 BREAK 120 DRAFT COLD BOX 113 RR 130 RR 129 ELECTRICAL 143 EXPO 107 BUS 108 COOLER 110 DISH 111 OFFICE 112 IT 118STAFF 128 DISH 135 DRY STOR. 134 FREEZER 133 COOLER 132 STORAGE 138 MCC 139 SHIPPING 142 ROASTER 104 OUTDOOR DINING 01 BOCCE AND FAMILY ROOM 02 HAMMOCK GROVE 03 OUTDOOR GAMING AREA 04 BEACH FIRE PIT 05 OUTDOOR RECREATIONAL SPACE 06 ELEVATED STAGE 07 KID SAFE PLAY AREA 08 DOG RUN 09 STORMWATER TREATMENT AREA 010 OUTDOOR STORAGE 011 TRASH AND RECYCLING COLLECTION 012 BOILER AND CHILLER 014 TOOL SHED 015 TOOL SHED 015 TOOL SHED 015 DROP-OFF AND PICK UP 013 X X X X X CAN SHOP 150 19'-8" 15 ' - 8 1 / 2 " RETAIL: SLAB ON GRADE WITH EPOXY PAINT, METAL FRAMED INSULATED WALLS/CEILINGS. UNCONDITIONED CORRUGATED METAL SILO SPACE AT REACH IN COOLERS RETAIL WARMING UNITS POS REACH IN COOLERS 150A 15 0 B R13'-0 " 3'-2" 1/16" = 1'-0" FIRST FLOOR PLAN - OVERALL 1/8" = 1'-0" ENLARGED PLAN - CAN SHOP - OPTION 1 Date: Job No: Sheet No: A Drawing: Drawn By: Checked By: GOLDEN ROAD BREWING 2210 E. ORANGEWOOD AVE. ANAHEIM, CA 92806 16034 19-OCT-2016 - - FIRST FLOOR PLAN - OVERALL A2.11 2 A2.11 2 A3.01 3 A3.01 1 A3.01 4 A3.01 1 A3.02 2 A3.02 1.(E) RESTROOM TO REMAIN. 2.FUTURE SHADE TRELLIS: PROVIDE ROUGH-INS FOR GAS, ELECTRICAL, AND WATER. 3.NEW ALUMINUM AND GLASS OVERHEAD DOOR. 4.NEW HORIZONTAL FOLDING ALUMINUM AND GLASS DOOR. 5.NEW ALUMINUM STOREFRONT AND ENTRANCE WHERE SHOWN. 6.LAMINATED BAR TOP WITH METAL-FRAMED DIE-WALL WITH WOOD FINISH AND FOOT RAIL. ASSUME ROUGH-INS FOR EQUIPMENT UNDER BAR. 7.CONCRETE BAR TOP WITH BREEZE BLOCK DIE-WALL. 8.WOOD FRAMED "TOOL SHED" WITH FOLDING, LOCKING DOORS ON OVERHEAD TRACK. INTERIOR: PAINTED CONCRETE WALL (EXISTING) WITH TVs, BEER TAPS, WARE WASHING, REFRIGERATOR, GLASS RACKS AND STORAGE. 9.CHANNEL GLASS WALL. 10.COFFEE ROASTER WITH GAS CONNECTION AND FLUE. 11.WOOD FRAMED ENTRY PORTAL (SIMILAR TO "TOOL SHEDS") WITH SIGNAGE SUPPORT. SEE ELEVATIONS. 12.INFILL EXISTING ARCHES WITH CONCRETE TO MATCH EXISTING WALL. 13.NEW METAL STUD WALL WITH GYPSUM BOARD. 14.SERVING TANKS BY OWNER. PROVIDE THICKENED SLAB AND TRENCH DRAIN. 15.NOT USED. 16.FEATURE BY OTHERS. PROVIDE ELECTRICAL CONNECTION. 17.BREWING/PACKAGING EQUIPMENT BY OTHERS. PROVIDE THICKENED SLAB AND TRENCH DRAINS. 18.NOT USED. 19.NEW GALVANIZED STEEL STAIR. 20.42" HIGH PAINTED STEEL SAFETY GUARDRAIL. 21.BARRELS, SEATING, MOBILE BAR, MOBILE STAGE BY OTHERS. 22.NEW LOUVER IN EXISTING OPENING. 23.NEW BUILT-IN-PLACE REFRIGERATED UNIT WITH REMOTE COMP. AND OVERHEAD DOORS. 24.NEW DISPLAY WALL WITH DIRECT-DRAW BEER TAPS AND UNDER COUNTED EQUIPMENT. 25.CASEWORK. 26.WOOD DECK OR GREEN ROOF ON MEMBRANE ROOFING ON CANTILEVERED FRAMING ON "TOOL SHED" STRUCTURE BELOW. 2 2 2 1 1 33 3 44 4 5 6 6 6 7 7 7 8 8 8 9 10 11 11 12 13 TYP 13 TYP 13 TYP 14 TYP 16 17 19 20 20 21 23 23 3 A4.01 3 A4.01 2 A4.01 2 A4.01 1 A4.01 1 A4.01 2 10/19/2016REV. 2 City of Anaheim INTERDEPARTMENTAL REVIEW COMMITTEE To: Amy Vazquez/Planning Department Case No.: DEV 2016-00015/CUP 2016-05860 Golden Road Brewing, Inc. 2210 – 2220 E. Orangewood Ave. Date: November 1, 2016 From: Lieutenant Tim Miller Anaheim Police Department Vice, Narcotics and Criminal Intelligence Section Commander Contact: Name: S.P.S.R. Michele Irwin Phone: 714-765-1461 Email: mmirwin@anaheim.net The Police Department has reviewed the above case. Please see the following comments and conditions for more information: COMMENTS: The Police Department has received an I.D.C. Route Sheet for DEV 2016-00015/CUP 2016-05860. The applicant is requesting to permit a brewery with a restaurant/banquet area and an outdoor beer garden with fewer parking spaces than required by the Zoning Code. RECOMMENDED CONDITIONS OF APPROVAL: The Police Department requests the following conditions be placed on the Conditional Use Permit: 1. Any Graffiti painted or marked upon the premises or on any adjacent area under the control of the licensee shall be removed or painted over within 24 hours of being applied. Police Department 2. The business shall not be operated in such a way as to be detrimental to the public health, safety or welfare. Police Department 3. Security measures shall be provided to the satisfaction of the Anaheim Police Department to deter unlawful conduct of employees and patrons, promote the safe and orderly assembly and movement of persons and vehicles, and to prevent disturbances to the neighborhood by excessive noise created by patrons entering or leaving the premises. Police Department ATTACHMENT NO. 7 4. Any and all security officers provided shall comply with all State and Local ordinances regulating their services, including, without limitation, Chapter 11.5 of Division 3 of the California Business and Profession Code. (Section 4.16.070 Anaheim Municipal Code) Police Department 5. Petitioner shall not share any profits, or pay any percentage or commission to a promoter or any other person, based upon monies collected as a door charge, cover charge, or any other form of admission charge, including minimum drink orders, or the sale of drinks. Police Department 6. The Can/Outside Retail Shop shall be closed 2 hours prior to events at the Stadium and remain closed through the event. It may re-open when the event has concluded. Police Department 7. Managers, owners, and wait staff need to call the Department of Alcoholic Beverage Control and obtain LEAD (Licensee Education on Alcohol and Drugs Program) Training. The contact number is 714-558-4101. Police Department 8. That subject alcoholic beverage license shall not be exchanged for a public premise (bar) type license nor shall the establishment be operated as a public premise as defined in Section 23039 of the Business and Professions Code. Police Department 9. The patio must be fenced and fully enclosed. If there is a pedestrian gate it must be self-closing and have a sign posted on the interior that reads “No alcohol beyond this point.” Police Department 10. Parking lots, driveways, circulation areas, aisles, passageways, recesses and grounds contiguous to buildings, shall be provided with enough lighting to illuminate and make clearly visible the presence of any person on or about the premises during the hours of darkness and provide a safe, secure environment for all persons, property, and vehicles onsite. Police Department 11. The petitioner(s) shall be responsible for maintaining free of litter the area adjacent to the premises over which they have control, as depicted. Police Department 12. At all times when the premise is open for business, the premise shall be maintained as a bona fide restaurant and shall provide a menu containing an assortment of foods normally offered in such restaurant. Police Department 13. All entertainment in the outdoor space (music, movies, poetry readings, etc.) shall conclude by 10p.m. Sunday thru Thursday, and 12 midnight Friday and Saturday. Police Department 14. Music in the outdoor space must be acoustic in nature with no amplification. Police Department 15. A security plan must be submitted to the Chief of Police or his designee for approval prior to the restaurant opening for business. Areas to be covered/discussed would be:  indoor event/concert/VIP area  game day rivals (Dodgers, Yankees, Red Sox’s)  eviction of over intoxicated individuals  regular business operations including the outdoor patio area. Police Department 16. A valet plan must be submitted to the Chief of Police or his designee for approval prior to the business opening. Police Department 17. The permitted event or activity shall not create sound levels which violate any ordinance of the City of Anaheim. Police Department 18. The number of persons attending an indoor event or in the restaurant space shall not exceed the maximum occupancy load as determined by the Anaheim Fire Department. Signs indicating the occupant load shall be posted in a conspicuous place on an approved sign near the main exit from the room. (Section 25.114(a) Uniform Fire Code) Police Department 19. Any violation of the application, or any attached conditions, shall be sufficient grounds to revoke the permit. Police Department f:\home\mmirwin\CUP\2015-00065 DEV 2210-2220 E Orangewood Golden Road Brewery-Restaurant conditions.doc AT T A C H M E N T NO. 8 STAGE MAIN KITCHEN 109 BARREL VAULT 114PREP KITCHEN 131 BREWERY 136 FEATURE 144 COLD BOX 141 BREWER'S OFFICE 140 PACKAGING 137 STREET 106 DINING ROOM 101 MEN 103 WOMEN 102 VIP ROOM 117 TANK BAR 105 CAN SHOP 150 RR 115 RR 116 STAIR 1 OFFICE 127 OFFICE 126 OFFICE 125 OFFICE 124 OFFICE 119 OFFICE 122 MEDIA 123 BREAK 120 DRAFT COLD BOX 113 RR 130 RR 129 ELECTRICAL 143 EXPO 107 BUS 108 COOLER 110 DISH 111 OFFICE 112 IT 118STAFF 128 DISH 135 DRY STOR. 134 FREEZER 133 COOLER 132 STORAGE 138 MCC 139 SHIPPING 142 ROASTER 104 OUTDOOR DINING 01 BOCCE AND FAMILY ROOM 02 HAMMOCK GROVE 03 OUTDOOR GAMING AREA 04 BEACH FIRE PIT 05 OUTDOOR RECREATIONAL SPACE 06 ELEVATED STAGE 07 KID SAFE PLAY AREA 08 DOG RUN 09 STORMWATER TREATMENT AREA 010 OUTDOOR STORAGE 011 TRASH AND RECYCLING COLLECTION 012 BOILER AND CHILLER 014 TOOL SHED 015 TOOL SHED 015 TOOL SHED 015 DROP-OFF AND PICK UP 013 X X X X X CAN SHOP 150 19'-8" 15 ' - 8 1 / 2 " RETAIL: SLAB ON GRADE WITH EPOXY PAINT, METAL FRAMED INSULATED WALLS/CEILINGS. UNCONDITIONED CORRUGATED METAL SILO SPACE AT REACH IN COOLERS RETAIL WARMING UNITS POS REACH IN COOLERS 150A 15 0 B R13'-0 " 3'-2" 1/16" = 1'-0" FIRST FLOOR PLAN - OVERALL 1/8" = 1'-0" ENLARGED PLAN - CAN SHOP - OPTION 1 Date: Job No: Sheet No: A Drawing: Drawn By: Checked By: GOLDEN ROAD BREWING 2210 E. ORANGEWOOD AVE. ANAHEIM, CA 92806 16034 19-OCT-2016 - - FIRST FLOOR PLAN - OVERALL A2.11 2 A2.11 2 A3.01 3 A3.01 1 A3.01 4 A3.01 1 A3.02 2 A3.02 1.(E) RESTROOM TO REMAIN. 2.FUTURE SHADE TRELLIS: PROVIDE ROUGH-INS FOR GAS, ELECTRICAL, AND WATER. 3.NEW ALUMINUM AND GLASS OVERHEAD DOOR. 4.NEW HORIZONTAL FOLDING ALUMINUM AND GLASS DOOR. 5.NEW ALUMINUM STOREFRONT AND ENTRANCE WHERE SHOWN. 6.LAMINATED BAR TOP WITH METAL-FRAMED DIE-WALL WITH WOOD FINISH AND FOOT RAIL. ASSUME ROUGH-INS FOR EQUIPMENT UNDER BAR. 7.CONCRETE BAR TOP WITH BREEZE BLOCK DIE-WALL. 8.WOOD FRAMED "TOOL SHED" WITH FOLDING, LOCKING DOORS ON OVERHEAD TRACK. INTERIOR: PAINTED CONCRETE WALL (EXISTING) WITH TVs, BEER TAPS, WARE WASHING, REFRIGERATOR, GLASS RACKS AND STORAGE. 9.CHANNEL GLASS WALL. 10.COFFEE ROASTER WITH GAS CONNECTION AND FLUE. 11.WOOD FRAMED ENTRY PORTAL (SIMILAR TO "TOOL SHEDS") WITH SIGNAGE SUPPORT. SEE ELEVATIONS. 12.INFILL EXISTING ARCHES WITH CONCRETE TO MATCH EXISTING WALL. 13.NEW METAL STUD WALL WITH GYPSUM BOARD. 14.SERVING TANKS BY OWNER. PROVIDE THICKENED SLAB AND TRENCH DRAIN. 15.NOT USED. 16.FEATURE BY OTHERS. PROVIDE ELECTRICAL CONNECTION. 17.BREWING/PACKAGING EQUIPMENT BY OTHERS. PROVIDE THICKENED SLAB AND TRENCH DRAINS. 18.NOT USED. 19.NEW GALVANIZED STEEL STAIR. 20.42" HIGH PAINTED STEEL SAFETY GUARDRAIL. 21.BARRELS, SEATING, MOBILE BAR, MOBILE STAGE BY OTHERS. 22.NEW LOUVER IN EXISTING OPENING. 23.NEW BUILT-IN-PLACE REFRIGERATED UNIT WITH REMOTE COMP. AND OVERHEAD DOORS. 24.NEW DISPLAY WALL WITH DIRECT-DRAW BEER TAPS AND UNDER COUNTED EQUIPMENT. 25.CASEWORK. 26.WOOD DECK OR GREEN ROOF ON MEMBRANE ROOFING ON CANTILEVERED FRAMING ON "TOOL SHED" STRUCTURE BELOW. 2 2 2 1 1 33 3 44 4 5 6 6 6 7 7 7 8 8 8 9 10 11 11 12 13 TYP 13 TYP 13 TYP 14 TYP 16 17 19 20 20 21 23 23 3 A4.01 3 A4.01 2 A4.01 2 A4.01 1 A4.01 1 A4.01 2 10/19/2016REV. 2 CLOSED KITCHEN CEILING SPACE CL O S E D R E S T R O O M CE I L I N G S P A C E SLOPED ROOFING BELOW (EXTERIOR) 2 A2.12 CONFERENCE 201 26 26 26 OPEN TO BELOW OPEN TO BELOW OPEN TO BELOW DN 13 13 13 13 13 1313 27 27 27 27 27 27 27 27 2 2 2 27 113'-4" 25 1 ' - 0 1 / 2 " 38 ' - 1 0 " 38 ' - 1 0 " 36 ' - 1 0 " 12 ' - 8 " 12 ' - 6 " 6'-6" 22 ' - 8 1 / 2 " 26 ' - 0 " 26 ' - 0 " 26 ' - 0 " 26 ' - 0 " 26 ' - 0 " 26 ' - 0 " 26 ' - 0 " 26 ' - 0 " 20 ' - 4 " 56'-8"56'-8" 13 ' - 2 " 6' - 2 " 3' - 2 " 10'-1"34'-10" 8' - 0 " 35 ' - 0 " 5'-0" 8' - 0 " 35 ' - 0 " 6' - 0 " 6' - 0 " 5'-6" 56'-7"35'-9"20'-0" 29 ' - 7 " 30'-0" 9'-6"20'-6" 12 ' - 0 " 9'-10" 12'-3"46'-6"23'-7" 9'-6" 17 ' - 6 " 12 ' - 8 " 20'-0"35'-9" 10 ' - 2 " 35'-2" 18 ' - 6 " 10 ' - 6 " 73 ' - 9 1 / 2 " 5'-0" 13 ' - 4 " CONFERENCE 201 26 26 13 20 20 3 19 201A 20 1 B 201C 201D 10'-3" ROOF LADDER 7'-6"2'-3"CL CL 4" 6' - 0 " CL EQEQ CL A2 A3 Date: Job No: Sheet No: A Drawing: Drawn By: Checked By: GOLDEN ROAD BREWING 2210 E. ORANGEWOOD AVE. ANAHEIM, CA 92806 16034 19-OCT-2016 - - SECOND FLOOR PLAN A2.121/16" = 1'-0" SECOND FLOOR PLAN 1/8" = 1'-0" ENLARGED SECOND FLOOR PLAN KEYNOTES 1.(E) RESTROOM TO REMAIN. 2.FUTURE SHADE TRELLIS: PROVIDE ROUGH-INS FOR GAS, ELECTRICAL, AND WATER. 3.NEW ALUMINUM AND GLASS OVERHEAD DOOR. 4.NEW HORIZONTAL FOLDING ALUMINUM AND GLASS DOOR. 5.NEW ALUMINUM STOREFRONT AND ENTRANCE WHERE SHOWN. 6.LAMINATED BAR TOP WITH METAL-FRAMED DIE-WALL WITH WOOD FINISH AND FOOT RAIL. ASSUME ROUGH-INS FOR EQUIPMENT UNDER BAR. 7.CONCRETE BAR TOP WITH BREEZE BLOCK DIE-WALL. 8.WOOD FRAMED "TOOL SHED" WITH FOLDING, LOCKING DOORS ON OVERHEAD TRACK. INTERIOR: PAINTED CONCRETE WALL (EXISTING) WITH TVs, BEER TAPS, WARE WASHING, REFRIGERATOR, GLASS RACKS AND STORAGE. 9.CHANNEL GLASS WALL. 10.COFFEE ROASTER WITH GAS CONNECTION AND FLUE. 11.WOOD FRAMED ENTRY PORTAL (SIMILAR TO "TOOL SHEDS") WITH SIGNAGE SUPPORT. SEE ELEVATIONS. 12.INFILL EXISTING ARCHES WITH CONCRETE TO MATCH EXISTING WALL. 13.NEW METAL STUD WALL WITH GYPSUM BOARD. 14.SERVING TANKS BY OWNER. PROVIDE THICKENED SLAB AND TRENCH DRAIN. 15.WOOD BOARDWALK (MATCH LANDSCAPE). SAWCUT SLAB AND PROVIDE DEPRESSED SLAB. 16.FEATURE BY OTHERS. PROVIDE ELECTRICAL CONNECTION. 17.BREWING/PACKAGING EQUIPMENT BY OTHERS. PROVIDE THICKENED SLAB AND TRENCH DRAINS. 18.NOT USED. 19.NEW STEEL STAIR. GALVANIZE AT EXTERIOR. 20.42" HIGH PAINTED STEEL SAFETY GUARDRAIL. 21.BARRELS, SEATING, MOBILE BAR, MOBILE STAGE BY OTHERS. 22.NEW LOUVER IN EXISTING OPENING. 23.NEW BUILT-IN-PLACE REFRIGERATED UNIT WITH REMOTE COMP. AND OVERHEAD DOORS. 24.NEW DISPLAY WALL WITH DIRECT-DRAW BEER TAPS AND UNDER COUNTED EQUIPMENT. 25.CASEWORK. 26.WOOD DECK OR GREEN ROOF ON MEMBRANE ROOFING ON CANTILEVERED FRAMING ON "TOOL SHED" STRUCTURE BELOW. 27.LINE OF CAP OF SPACE BELOW. GENERAL NOTES A.XXX LEGEND (E) CONCRETE WALL NEW WALL, REFER TO ASSEMBLIES SHEET 2 10/19/2016REV. 2 X X X X DUPONT (WEST) NOPARKINGNOPARKING NO PARKING NO PARKING N O P A R K I N G NO PARKING 1 9 3 1 2 9 2 8 7 2 7 1 8 1 1 1 5 5 4 0 1 4 1 3 7 3 6 2 4 2 1 6 3 2 5 3 9 3 6 3 8 15 3 0 1 7 3 6 2 6 1 4 1 6 2 3 3 5 1 0 4 9 6 3 2 5 4 0 7 8 4 6 3 2 4 9 5 0 51 5 1 4 4 3 1 1 1 4 5 3 3 3 4 5 4 3 4 2 4 1 2 4 6 2 2 1 2 4 7 4 8 2 0 2 2 1 3 2 1 52 9 7 5 4 5 3 4 3 53 ACCENT PALM TREES WASHINGTONIA FILIFERA / CALIFORNIA FAN PALM20` B.T.H. STREET TREE - DUPONT DRIVE LAGERSTROEMIA INDICA / CRAPE MYRTLE36" BOX STREET PALM TREE - ORANGWOOD AVE WASHINGTONIA FILIFERA / CALIFORNIA FAN PALM20` B.T.H. SPECIMEN TREE CITRUS X SINENSIS `VALENCIA` / SWEET ORANGE96" BOX PARKING LOT TREE GEIJERA PARVIFLORA / AUSTRALIAN WILLOW36" BOX LOPHOSTEMON CONFERTUS / BRISBANE BOX36" BOX STREET TREE - ORANGEWOOD AVE JACARANDA MIMOSIFOLIA / JACARANDA36" BOX EXISTING EXISTING TREE / PROTECT IN PLACEEXISTING ACCENT PALMS BRAHEA ARMATA / MEXICAN BLUE PALM24" BOX CHAMAEROPS HUMILIS / MEDITERRANEAN FAN PALM24" BOX LANDSCAPE AREA - SHRUBS & GROUNDCOVER ACHILLEA MILLEFOLIUM / COMMON YARROW1 GAL AGAVE ATTENUATA / AGAVE1 GAL ALOE SPP. / ALOE1 GAL BOUGAINVILLEA SPP. / BOUGAINVILLEA1 GAL CAREX SPP. / SEDGE1 GAL CISTUS X PURPUREUS / ORCHID ROCKROSE1 GAL DESCHAMPSIA CESPITOSA / TUFTED HAIR GRASS1 GAL DYMONDIA MARGARETAE / DYMONDIA1 GAL ECHEVERIA HYBRIDS / HYBRID ECHEVERIA1 GAL FICUS PUMILA / CREEPING FIG1 GAL HEBE SPECIOSA `VARIEGATA` / VARIEGATED HEBE1 GAL HESPERALOE PARVIFLORA / RED YUCCA1 GAL LAVANDULA SPP. / LAVENDER1 GAL LIMONIUM PEREZII / STATICE1 GAL MANDEVILLA SPLENDENS / MANDEVILLA1 GAL OSTEOSPERMUM FRUTICOSUM / FREEWAY DAISY1 GAL PENNISETUM MESSIACUM `RED BUNNY TAILS` / FOUNTAIN GRASS1 GAL PENNISETUM SPATHIOLATUM / RYE PUFFS1 GAL PITTOSPORUM TENUIFOLIUM `SILVER SHEEN` / TAWHIWHI1 GAL PODOCARPUS MACROPHYLLUS MAKI / SHRUBBY YEW1 GAL RHAMNUS CALIFORNICA `EVE CASE` / CALIFORNIA COFFEEBERRY1 GAL SALVIA LEUCANTHA `SANTA BARBARA` / MEXICAN BUSH SAGE1 GAL SANTOLINA CHAMAECYPARISSUS / LAVENDER COTTON1 GAL SEDUM SPP. / SEDUM SPECIES1 GAL SENECIO MANDRALISCAE / BLUE FINGER1 GAL SESLERIA AUTUMNALIS / AUTUMN MOOR GRASS1 GAL TECOMA CAPENSIS / CAPE HONEYSUCKLE1 GAL TECOMA STANS / YELLOW BELLS1 GAL WESTRINGIA FRUTICOSA / COAST ROSEMARY1 GAL CONCEPT PLANT SCHEDULE: 50% 1 GAL. & 50% 5 GAL. EXISTING CURB TO REMAIN PROPOSED 5` WIDE CONCRETE SIDEWALK EXISTING BUILDING TO BE RENOVATED PER ARCHITECTURAL PLANS PROPOSED CAN SHOP PER ARCHITECTURAL PLANS PROPERTY LINE, TYPICAL HARDSCAPE – TYPE 1, TYPICAL HARDSCAPE – TYPE 2, TYPICAL HARDSCAPE – TYPE 3, TYPICAL HARDSCAPE – TYPE 4, TYPICAL YARD GAME AREA SAND, TYPICAL RAISED WOOD DECK 123456789101112 LEGENDPROPOSED INDOOR GO L F S I M U L A T O R PER ARCHITECTURE PL A N S EXISTING ASPHALT PAR K I N G L O T T O B E R E N O V A T E D HAMMOCK GROVE FIRE FEATURE, TYPICAL BENCH SWING SAND PLAY AREA WITH F E A T U R E E L E M E N T DOG AREA (SYNTHETIC T U R F ) OUTDOOR BAR PER ARC H I T E C T U R A L P L A N S SECURITY FENCE SITE FURNISHINGS - TYP I C A L RAISED TREE PLANTER 1314151617181920212223 P L A N T E D P O T 4 2 ” H I G H F E N C E 6 ’ H I G H P E R I M E T E R F E N C E 4 ' H I G H F E N C E F L U S H C O N C R E T E M E D A L L I O N W I T H L O G O V A L E T P I C K U P A N D D R O P O F F A R E A P I C K U P A N D D R O P O F F A R E A A D A R A M P – T Y P I C A L 6 ’ W I D E D O U B L E G A T E , T Y P I C A L C O M M E R C I A L L O A D I N G A N D U N L O A D I N G A R E A R E L O C A T E D T R A N S F O R M E R F U T U R E O U T D O O R P R O J E C T O R 2 4 2 5 2 6 2 7 2 8 2 9 3 0 3 1 3 2 3 3 3 4 3 5 F U T U R E S H A D E S T R U C T U R E P E R A R C H I T E C T U R A L P L A N S U L T I M A T E R I G H T - O F - W A Y B O C C E B A L L C O U R T L E A N B A R - T Y P I C A L B R A N D S I G N A G E / S C U L P T U R E 1 2 ' W I D E D O U B L E G A T E 3 ' W I D E S I N G L E G A T E S E A T W A L L B I K E R A C K S G R E E N R O O F O V E R B A R 4 ' H I G H W O O D S L A T T E D F E N C E 3 6 3 7 3 8 3 9 4 0 4 1 4 2 4 3 4 4 4 5 4 6 G A L V A N I Z E D S T A I R S E L E V A T E D D E C K R E M O V A B L E B O L L A R D S T R A S H & R E C Y C L I N G C O L L E C T I O N B I O - B A S I N S T O R M W A T E R T R E A T M E N T S T R U C T U R E P E R C I V I L E N G I N E E R I N G P L A N S C O N C R E T E S T A I R S S L O P E D W A L K W A Y 4 7 4 8 4 9 5 0 5 1 5 2 5 3 5 4 N O T E S : 1 . L A N D S C A P E D O C U M E N T A T I O N P A C K A G E A N D A C E R T I F I C A T I O N O F C O M P L E T I O N A R E R E Q U I R E D F O R C O M P L I A N C E W I T H C H A P T E R 1 0 . 1 9 O F T H E A N A H E I M M U N I C I P A L C O D E A N D O R D I N A N C E N O . 6 1 6 0 R E L A T I N G T O L A N D S C A P E W A T E R E F F I C I E N C Y . C O M P L I A N C E W I T H T H E S E C O D E R E Q U I R E M E N T S I S R E Q U I R E D A T T H E T I M E O F I S S U A N C E O F B U I L D I N G P E R M I T S . 2 . S E P A R A T E I R R I G A T I O N M E T E R S H A L L B E I N S T A L L E D I N C O M P L I A N C E W I T H C H A P T E R 1 0 . 1 9 O F T H E A N A H E I M M U N I C I P A L C O D E A N D O R D I N A N C E N O . 6 1 6 0 R E L A T I N G T O L A N D S C A P E W A T E R E F F I C I E N C Y . C O M P L I A N C E W I T H T H E S E C O D E R E Q U I R E M E N T S I S R E Q U I R E D A T T H E T I M E O F I S S U A N C E O F B U I L D I N G P E R M I T S . 0 1 0 2 0 4 0 1 " = 2 0 ' - 0 " S C A L E : NORTH O R A N G E W O O D A V E N U E SOUTH DUPONT DRIVE SOUTH DUPONT DRIVE R e v i s i o n # 2 1 0 / 1 9 / 2 0 1 6 D a t e : J o b N o : S h e e t N o : S E | A S C O T T E D W A R D S A R C H I T E C T U R E L L P | 2 5 2 5 E . B u r n s i d e S t . , P o r t l a n d , O R 9 7 2 1 4 p h o n e : ( 5 0 3 ) 2 2 6 - 3 6 1 7 w w w . s e a l l p . c o m D r a w i n g : D r a w n B y : C h e c k e d B y : G O L D E N R O A D B R E W I N G A N A H E I M , C A L I F . 1 6 - 5 0 3 1 9 - O C T - 2 0 1 6 L C , M M J B L - 1 . 0 2 2 1 0 EXIST ROOF SLOPE DIRECTION EXIST ROOF SLOPE DIRECTION EX I S T R O O F SL O P E EX I S T R O O F SL O P E RO O F S L O P E DI R E C T I O N 444 4 ROOF SLOPE 1 1 3 FLUE 1 2 5 1 4 12 2 DS DS DS DS DS DS DS 6 7 7 8 7 8 7 7 7 9 9 99 9 9 9 11 11 1 RO O F S L O P E DI R E C T I O N 12 2 .12 .12 7 A7.51 2 A7.51 5 A7.51 Date: Job No: Sheet No: A Drawing: Drawn By: Checked By: GOLDEN ROAD BREWING 2210 E. ORANGEWOOD AVE. ANAHEIM, CA 92806 16034 19-OCT-2016 - - ROOF PLAN A2.21 1/16" = 1'-0" ROOF PLAN KEYNOTES 1.MECHANICAL SCREEN: PERFORATED CORRUGATED METAL ON GALVANIZED METAL FRAMING, BRACE TO STRUCTURE. 2.ROOF HATCH. TO BE COORDINATED WITH FINAL ROOF TOP UNIT LOCATIONS. 3.ROOF MOUNTED ADDRESS NUMBERS. 4.STANDING SEAM METAL ROOFING. 5.EXISTING BUILT UP ROOFING. PATCH AS REQUIRED. 6.CUT EXISTING PARAPET ARCHES FOR CONTINUOUS FLAT PARAPET. REFER TO ELEVATIONS FOR PARAPET PROFILE. 7.EXISTING SKYLIGHT. VERIFY LOCATION. 8.DEMOLISH EXISTING SKYLIGHT AND CURB. PROVIDE NEW ROOF SHEATHING AND MEMBRANE AS REQUIRED. 9.NEW SKYLIGHT AND CURB ASSEMBLY. PROVIDE NEW STRUCTURAL FRAMING TO SUPPORT SKYLIGHT. 10.SALVAGED GIRDER FROM DEMOLITION OF ADJACENT BUILDING. CUT TO REQUIRED LENGTH. 11.ROOF OF TOOL SHED BAR BELOW. 12.GUTTER. 2 10/19/2016REV. 2 Date: Job No: Sheet No: A Drawing: Drawn By: Checked By: GOLDEN ROAD BREWING 2210 E. ORANGEWOOD AVE. ANAHEIM, CA 92806 16034 19-OCT-2016 - - BUILDING SECTIONS A4.01 1/8" = 1'-0" BUILDING SECTION 1/8" = 1'-0" BUILDING SECTION 1/8" = 1'-0" BUILDING SECTION - CONTINUED 1/8" = 1'-0" BUILDING SECTION KEYNOTES 1.MECHANICAL SCREEN BEYOND. EXPANDED METAL. 2 10/19/2016REV. 2 B.O. Sign: ±13'-0" A.F.G. B.O. Sign: ±1'-6" A.F.G. 42'-0" 4' - 0 " 35'-0" 7 ' - 0 " 13'-0" 2' - 6 " 10'-0" 2' - 6 " SIGN SPECIFICATIONS: Dimensional colored backlit acrylic letters, sitting in front of perforated metal screen with branding graphic. LOCATION: North Elevation SIGN SPECIFICATIONS: Prefabricated prefinished flat cut letters LOCATION: West Elevation SIGN SPECIFICATIONS: Painted supergraphic on prefinished metal siding. LOCATION: West Elevation of Can Shop SIGN SPECIFICATIONS: Dimensional lettering on new illuminated wood panel / concrete monument sign. LOCATION: West/East Elevations B.O. Sign: ±5'-0" A.F.G. 3'-8" 1' - 8 " B.O. Sign: ±10'-4" A.F.G. 12'-0" 3' - 0 " B.O. Sign: ±7'-0" A.F.G. SIGN SPECIFICATIONS: Painted graphic on painted concrete. LOCATION: North Elevation SIGN SPECIFICATIONS: Painted graphic on painted concrete. LOCATION: West Elevation GOLDEN ROAD BREWING 2210 E. ORANGEWOOD AVE 1 B.O. Sign: ±2'-3" A.F.G. 1 2 2 3 3 9 5 6 7 7 6 5 8 43'-0" 6 ' - 0 " SIGN SPECIFICATIONS: Painted graphic on painted concrete. LOCATION: North Elevation B.O. Sign: ±12'-0" A.F.G. 8 9 8'-9" 6' - 3 " B.O. Sign: ±2'-6" A.F.G. SIGN SPECIFICATIONS: Painted graphic on prefinished metal siding. LOCATION: East Elevation of Can Shop 2 REV. 2 10/19/2016 ATTACHMENT NO. 9 Date: Job No: Sheet No: A Drawing: Drawn By: Checked By: GOLDEN ROAD BREWING 2210 E. ORANGEWOOD AVE. ANAHEIM, CA 92806 16034 19-OCT-2016 - - SIGNAGE PLAN BUILDING ELEVATIONS S2 3/32" = 1'-0" ORANGEWOOD AVENUE ELEVATION - FOREGROUND 3/32" = 1'-0" ORANGEWOOD AVENUE MINOR ELEVATION 3/32" = 1'-0" DUPONT (EAST) ELEVATION 3/32" = 1'-0" ORANGEWOOD AVENUE ELEVATION 0'-0" (+148.25')T.O. (E) SLAB 20'-8" T.O. (E) PARAPET 0'-0" (+148.25')T.O. (E) SLAB 20'-8" T.O. (E) PARAPET 0'-0" (+148.25') T.O. (E) SLAB 20'-8"T.O. (E) PARAPET21'-4"T.O. (E) PARAPET CAN SHOP - OPTION 1 CAN SHOP - OPTION 1 2 REV. 2 10/19/2016 SITE LIN E PAINTED MURAL/ BANNER/ SUPERGRAPHICS 6 1 PAINTED WALL PATTERN ON EXISTING CONCRETE 1 8 9 NOTE: NUMBERS REFERENCE SIGN INDEX ON SHEET S1 ATTACHMENT NO. 9 Date: Job No: Sheet No: A Drawing: Drawn By: Checked By: GOLDEN ROAD BREWING 2210 E. ORANGEWOOD AVE. ANAHEIM, CA 92806 16034 19-OCT-2016 - - SIGNAGE PLAN BUILDING ELEVATIONS S3 3/32" = 1'-0" SOUTH ELEVATION 3/32" = 1'-0" DUPONT (WEST) ELEVATION 0'-0" (+148.25')T.O. (E) SLAB 20'-0"T.O. (E) PARAPET 0'-0" (+148.25') T.O. (E) SLAB 20'-0"T.O. (E) PARAPET CAN SHOP - OPTION 1 CAN SHOP - OPTION 1 2 REV. 2 10/19/2016 SITE LINE EXISTING POWER LINE EXISTING POWER LINEEXISTING POWER LINE PAINTED MURAL/ BANNER/ SUPERGRAPHICS9 2 7 3 ATTACHMENT NO. 9 2210 E Orangewood Ave Anaheim, CA 92806 19-OCT-2016 | Project #16034 NORTHEAST CORNER AERIAL GOLDEN ROAD BREWING - ANAHEIM R-1 2 REV. 2 - 10/19/2016 ATTACHMENT NO. 10 2210 E Orangewood Ave Anaheim, CA 92806 19-OCT-2016 | Project #16034 NORTHWEST CORNER AERIAL GOLDEN ROAD BREWING - ANAHEIM R-2 CITY OF ANAHEIM ENVIRONMENTAL CHECKLIST FORM CLASS 32 CATEGORICAL EXEMPTION INFILL DEVELOPMENT PROJECTS** CASE NO.: DEVELOPMENT CASE NO. 2016-00015 PARCEL A CONDITIONAL USE PERMIT NO. 2016-05860 VARIANCE NO. 2016-05063 DETERMINATION OF PUBLIC CONVENIENCE OR NECESSITY NO. 2016- 00131 PARCEL B CONDITIONAL USE PERMIT NO. 2016-05890 PROJECT APPLICANT: PARCEL A OWNER COMPANY: Custom Craft Beer, LLC dba Golden Road Brewing ADDRESS: 2210 East Orangewood Avenue CITY/ST/ZIP: Anaheim, CA 92806 E-MAIL: Brandon.smith@goldenroad.la PHONE: (949) 358-0755 APPLICANT NAME: Brandon Smith COMPANY: Custom Craft Beer, LLC dba Golden Road Brewing ADDRESS: 2210 East Orangewood Avenue CITY/ST/ZIP: Anaheim, CA 92806 E-MAIL: Brandon.smith@goldenroad.la PHONE: (949) 358-0755 PARCEL B OWNER NAME: Trevor Tait COMPANY: 2130 Orangewood, LLC ADDRESS: 701 N. Parkcenter Drive CITY/ST/ZIP: Santa Ana, CA 92705 PHONE: (714) 560-8653 APPLICANT: NAME: Brandon Smith COMPANY: Custom Craft Beer, LLC dba Golden Road Brewing ADDRESS: 2210 East Orangewood Avenue CITY/ST/ZIP: Anaheim, CA 92806 E-MAIL: Brandon.smith@goldenroad.la PHONE: (949) 358-0755 ATTACHMENT NO. 11 PROJECT ADDRESS: PARCEL A: 2210 and 2220 East Orangewood Avenue PARCEL B: 2130 East Orangewood Avenue APN(s): PARCEL A: 083-27-201 PARCEL B: 083-27-113 PROJECT LOCATION: SURROUNDING LAND USES AND SETTING: PARCEL A: Surrounding land uses include The George apartments, currently under construction, and Angel Stadium across Orangewood Avenue to the north; and, industrial businesses to the south and across Dupont Drive to the east and west, including Parcel B described below. PARCEL B: Surrounding land uses include vacant land approved for mixed use development (the LT Platinum Project) across Orangewood Avenue to the north; industrial businesses, including Parcel A (described above), across Dupont Drive to the east; industrial businesses to the south; and the Gateway Apartment Homes to the west. PROJECT DESCRIPTION: The applicant is proposing to partially demolish and construct improvements to the existing 58,500 square foot industrial building/brewery located on Parcel A. The eastern half of the building would undergo a phased demolition to include the removal of the roof and three walls, leaving the existing slab as a temporary construction staging area. The foundation would eventually be demolished for the establishment of an outdoor dining, entertainment and recreation area. The remaining structure would largely be left intact, with areas of selective demolition to provide new building openings and interior improvements. The first floor of the remodeled building would include a brewery with a packing and shipping area, restaurant, bar, two kitchens, roaster area, tank bar, storage, offices and barrel room with a stage and VIP room. The barrel room would primarily be for storing and ageing beer, but on occasion would provide an area for private events. These private events would include weddings, music performances, and other planned gatherings. The maximum number of guests permitted for these events would not exceed 170 people to ensure compliance with the submitted parking demand study. Most of the second floor would be open to below. A small section of the second floor would be improved with a conference room for Golden Road Brewing corporate meetings. The outdoor dining, entertainment and recreation area would include food service, three outdoor bars, bocce ball court, gaming area, hammock grove, kid-safe play area, dog run, community and semi-private outdoor dining, swings, fire pits, projector screen and a platform stage for outdoor events. A 580 square foot, detached retail space would be constructed at the northwest corner of the building. The retail building would be manned during business hours, selling branded merchandise and retail packaged beer in cans and bottles. Beer sales in the retail shop would be suspended before and during events at Angels Stadium, as recommended by the Police Department. The retail shop would be designed to resemble a silo with integrated signage, fencing, bike parking, hardscape features and layered landscaping. This building and adjacent outdoor space were designed to provide an architectural element near the corner of Dupont Drive and Orangewood Avenue and to create an extension of public right-of-way that would encourage biking and walking to the facility. A total of 320 parking spaces are required for the project and 239 spaces are proposed. 75 parking spaces would be provided on-site. An additional 164 parking spaces would be provided directly across Dupont Drive, on Parcel B. The parking on Parcel B would be provided in the existing parking lot and within an industrial building. The indoor spaces would be available to patrons at all times, but would be reserved by security and valet services on the days that special events would be held at the facility. No physical modifications are being made to the off-site parking location. Because all Code required parking would not be provided on or off-site, the applicant is requesting a parking variance for Parcel A and a conditional use permit for off-site parking for Parcel B. PARCEL A GENERAL PLAN DESIGNATION: Mixed Use ZONING: “I” Industrial Zone and the “PTMU” Platinum Triangle Mixed Use Overlay Zone PARCEL B GENERAL PLAN DESIGNATION: Mixed Use ZONING: “I” Industrial Zone and the “PTMU” Platinum Triangle Mixed Use Overlay Zone INFORMATION DEMONSTRATING THAT THE PROJECT SATISFIES THE CONDITIONS DESCRIBED IN SECTION 15332 OF TITLE 14 OF THE CALIFORNIA CODE OF REGULATIONS: 1. Is the project consistent with the applicable general plan designation and all applicable general plan policies as well as with applicable zoning designation and regulations? Both Parcel A and Parcel B are located in the Platinum Triangle within the “I” Industrial Zone and the “PTMU” Platinum Triangle Mixed Use Overlay Zone. The General Plan designates the property for Mixed Use land uses. The proposed project is consistent with the general plan and zoning, however, a variance is requested to all ow for fewer parking spaces than required by the Zoning code on Parcel A, and Parcel B would provide off- site parking for Parcel A. 2. Is the proposed development located within the City limits on a project site of no more than five acres substantially surrounded by urban uses? Parcel A is 2.5-acres, and Parcel B is 1.3-acres, which total less than 5 acres. Surrounding land uses to Parcel A include The George apartments, currently under construction, and Angel Stadium across Orangewood Avenue to the north; and, industrial businesses to the south and across Dupont Drive to the east and west, including Parcel B described below. Surrounding land uses to Parcel B include vacant land approved for mixed use development (the LT Platinum Project) across Orangewood Avenue to the north; industrial businesses, including Parcel A (described above), across Dupont Drive to the east; industrial businesses to the south; and the Gateway Apartment Homes to the west. 3. Does the project site have value as habitat for endangered, rare or threatened species? The project site is currently developed with a light industrial building and has no habitat value for endangered, rare or threatened species. 4. Would approval of the project result in any significant effects relating to traffic, noise, air quality, or water quality? a. Traffic: Construction - There would be a temporary minor increase in traffic due to construction vehicles during the construction phase. However, this impact would be temporary. No significant impacts would occur. Operation - The Proposed Project consists of the demolition of 2220 East Orangewood Avenue, and interior renovations of the remaining building at 2210 East Orangewood Avenue for a restaurant, tank bar/tasting room, brewing operations, and an office. Outdoor space created by the demolition of 2220 East Orangewood Avenue would provide outdoor dining for the full-service restaurant, recreational space, and some seating area for walk-up food and beverage service. The City of Anaheim Traffic Study Guidelines state that a traffic study is required when a project is expected to generate 100 or more new vehicle trips in the AM or PM peak hour, would contribute 51 or more peak- hour trips to any Congestion Management Program (CMP) monitored intersection, would generate 1,600 daily trips if located on the CMP highway system, or would generate 2,400 daily trips if adjacent to the CMP highway system. The Institute of Traffic Engineers (ITE) Trip Generation Manual methodology estimates that the Proposed Project would generate 1,361 average daily trips (ADT), 60 of which would occur in the a.m. peak hour and 144 of which would occur in the p.m. peak hour. The existing 57,000 square feet of light industrial space would be estimated to generate 397 daily trips, 52 of which would occur in the a.m. peak hour and 56 of which would occur in the p.m. peak hour. Therefore, the net project trip generation is 964 daily trips, of which 8 would occur in the a.m. peak hour and 88 of which would occur in the p.m. peak hour. Since the proposed project generates less than 100 net trips in the peak hour, a traffic study was determined to not be required nor prepared. Neither roadway segments nor immediately surrounding intersections are anticipated to be significantly impacted as a result of the additional trips from the Proposed Project. b. Noise: Construction - The Proposed Project would generate temporary noise during construction activities. Equipment used during construction could create noise impacts through the duration of the construction process. However, these impacts are temporary and would cease upon completion of construction. Chapter 6.70 of the City’s noise ordinance exempts construction noise between the hours of 7:00 a.m. and 7:00 p.m., Monday through Saturday. Adherence to the City Noise ordinance would result in no significant impacts. Operation - The Proposed Project is a brew pub to include an event space, an outdoor dining and recreational/entertainment area with on and off-premises sales and consumption of alcoholic beverages and a coordinated sign program that, when constructed, would generate noise impacts consistent with those of surrounding land uses. No significant impacts would occur. c. Air Quality: The Proposed Project site is located within SoCAB which is characterized by relatively poor air quality and is a Federal- and State-designated nonattainment area for O3, PM10 and PM2.5 (US EPA 2012). SCAQMD has established significance thresholds for both construction and operational activities relative to these criteria pollutants. Based on the following analysis, implementation of the Proposed Project would result in less than significant impacts relative to the daily significance thresholds for criteria air pollutant construction emissions established by the SCAQMD. Construction - The proposal consists of the demolition of light industrial building and the construction of a brew pub to include an event space, an outdoor dining and recreational/entertainment area with on and off-premises sales and consumption of alcoholic beverages and a coordinated sign program on a 2.5-acre parcel. General construction activities, such as site preparation, including demolition of the existing light industrial building, grading, and travel by construction workers can contribute to air pollutants. All construction activities would comply with SCAQMD Rule 403 (SCAQMD 2005) regarding the control of fugitive dust emissions, and existing City dust suppression practices that minimize dust and other emissions. Such controls include frequent watering of the site, the covering and/or wetting of trucks hauling dirt, sand, soil or other loose materials off-site, street sweeping, as needed, to remove dirt dropped by construction vehicles or mud that would otherwise be carried off by trucks departing the site, suspending grading and excavation activities in high winds (25 miles per hour [mph] or more) as well as implementation of a traffic control plan to minimize traffic flow interference from construction activities, etc., that would be incorporated into the construction plans. Construction is conservatively anticipated to last 6 months and construction would be broken into three phases: demolition, grading, and building construction (which consists of building construction, paving, and architectural coating). Pollutant emissions resulting from Proposed Project construction activities were calculated using the CalEEMod model. Construction emissions are based on conservative assumptions, which imply a default equipment mix and a worst-case construction schedule. As shown in Table 1, entitled “Project-Related Construction and Operational Emissions,” the incremental increase in emissions from Proposed Project construction activities fall well below SCAQMD significance thresholds for regional emissions. Operation - The Proposed Project’s incremental increase in regional emissions resulting from operation of the Proposed Project would not exceed any SCAQMD thresholds. Mobile source emission calculations utilize the vehicle miles traveled (VMT) rate calculated by CalEEMod, based on the specific proposed land use and intensity. The daily VMT rate is based on the number of daily trips for each land use and applied to a commute percentage and an average trip length, both of which are land use specific values derived from CalEEMod. These values account for variations in trip frequency and length associated with commuting to and from the Proposed Project. Emission factors specific to the buildout year are projected based on SoCAB-specific fleet turnover rates and the impact of future emission standards and fuel efficiency standards. The increase in the consumption of fossil fuels to provide power, heat, and ventilation was considered in the calculations as stationary point source emissions. Future fuel consumption rates are estimated based on land use specific energy consumption rates. The emission factors used in this analysis represent a State-wide average of known power producing facilities, utilizing various technologies and emission control strategies, and do not take into account any unique emissions profile. At this time, these emission factors are considered conservative and representative. Area source emissions were calculated by CalEEMod and include emissions from natural gas and landscape fuel combustion, consumer products, and architectural coatings (future maintenance). As shown in Table 1, the operational emissions pollutant concentrations resulting from Proposed Project operation would not exceed SCAQMD thresholds. Therefore, air quality impacts would be less than significant. Table 1 Project-Related Construction and Operational Emissions Mass Daily Thresholds (pounds per day) VOC NOx CO SO2 PM10 PM2.5 Construction Emissions SCAQMD Threshold 75 100 550 150 150 55 2017 Project Emissions 13 77 43 .08 11 7 Exceed Threshold? NO NO NO NO NO NO VOC NOx CO SO2 PM10 PM2.5 Operational Emissions SCAQMD Threshold 55 55 550 150 150 55 Project Emissions 6 21 51 .15 12 4 Exceed Threshold? NO NO NO NO NO NO Source of emissions: CalEEMod 2013.2.2 Source of thresholds: SCAQMD Regional emissions refer to the ambient conditions surrounding the site. Therefore, pollutant emissions associated with construction of the Proposed Project would be less than significant. Operational related impacts are typically associated with emissions produced from Project- generated vehicle trips. Based on the Proposed Project’s anticipated compliance with SCAQMD Rule 403 and the scale of development, it is anticipated that no significant impacts would occur to existing air quality standards. d. Water Quality: Grading and construction associated with site work on the project site would result in temporary disturbance of surface soils, which could potentially result in erosion and sedimentation on site, which are major visible water quality impacts attributable to construction activities. Any stockpiles of excavated areas would be susceptible to high rates of erosion from wind and rain and, if not manage properly, could result in increased sedimentation in local drainage ways. The Proposed Project must comply with the requirements of the National Pollutant Discharge Elimination System (NPDES) MS4 Permit. The NPDES MS4 Permit Program, which is administered in the project area by the City of Anaheim and County of Orange, issued by the Santa Ana Regional Water Quality Control Board (SARWQCB), helps control water pollution by regulating point sources that discharge pollutants into receiving waters. The Proposed Project operation must also comply with the NPDES General Construction Permit. The contractor would be required to comply with Chapter 10.09 of the Anaheim Municipal Code, which prohibits the active or passive discharge or disposal of soil or construction debris into the storm drain. Additionally, the Proposed Project would be required to obtain coverage under the General Permit for Discharges of Storm Water Associated with Construction Activity (Construction General Permit Order 2009-0009- DWQ). Construction activities subject to the Construction General Permit includes clearing, grading, and disturbances to ground such as stockpiling or excavation. The Construction General Permit requires implementation of a Storm Water Pollution Prevention Plan (SWPPP). The SWPPP would generally contain a site map showing the construction perimeter, existing and proposed buildings, storm water collection and discharge points, general pre- and post-construction topography, drainage patterns across the site, and adjacent roadways. The SWPPP must also include project construction features designed to protect against stormwater runoff, known as Best Management Practices (BMPs). Additionally, the SWPPP must contain a visual monitoring program; a chemical monitoring program for “non-visible” pollutants, should the BMPs fail; and a sediment monitoring plan, should the site discharge directly into a water body listed on the 303(d) list for sediment. Section A of the Construction General Permit describes the elements that must be contained in the SWPPP. Incorporation of these policies and ordinances and the requirements contained within would reduce project impacts to less than significant. 5. Can the project site be adequately served by all required utilities and public services? a. Fire Protection: The construction of a brew pub to include an event space, an outdoor dining and recreational/entertainment area with on and off-premises sales and consumption of alcoholic beverages and a coordinated sign program would not result in an increase of new residents, which could incrementally increase demands for fire protection services. However, the increased demand for fire protection services would be considered minimal and would be met with existing fire resources. Impacts to fire services are anticipated to be adequately funded by an increase in tax revenue, over an extended period of time, relative to the increase in development intensity. Additional fire personnel and associated facilities and equipment would be provided through the annual Operating Budget and Capital Improvement Program review process. Annually, Fire Department needs would be assessed and budget allocations revised accordingly to ensure that adequate levels of service are maintained throughout the City. Building plans submitted for new development on the project site would be required to comply with fire safety requirements. Additionally, development of the project site would not result in the need for new or physically altered fire protection facilities. Impacts to fire services would be less than significant. b. Police Protection: The construction of a brew pub to include an event space, an outdoor dining and recreational/entertainment area with on and off-premises sales and consumption of alcoholic beverages and a coordinated sign program would not result in an increase of new residents, which could incrementally increase demands for police services. Staff does not anticipate that the addition of alcoholic beverage sales at this location would contribute to an increase in crime if the business is operated in a responsible manner and in compliance with the recommended conditions of approval. These conditions include typical Police Department conditions for similar uses, such as: prohibiting any exterior advertising of alcoholic beverages; requiring ABC LEAD (Licensee Education on Alcohol and Drugs) training for employees; and limiting the display area of alcoholic beverages, among others. Development of the project site would not result in the need for new or physically altered police protection facilities. Impacts to police services would be less than significant. c. Schools: The Proposed Project would include the construction of brew pub to include an event space, an outdoor dining and recreational/entertainment area with on and off-premises sales and consumption of alcoholic beverages and a coordinated sign program, resulting in no increase of new residents. Therefore, the Proposed Project would not significantly impact school services. d. Parks: The Proposed Project would not generate new residents that may utilize recreational facilities in the City. According to the Anaheim General Plan/Zoning Code Update EIR No. 330, the City has a goal of providing at least two acres of parkland per 1,000 residents. In order to help achieve this goal, AMC Section 17.34.010 requires residential developments to pay a park impact fee prior to the issuance of building permits in order to offset the increase in demand and use of recreational facilities. There is no residential component to the Proposed Project; therefore, no significant impacts would occur. The proposed project includes outdoor dining, entertainment and recreation area for patrons of the business that would include food service, three outdoor bars, bocce ball court, gaming area, hammock grove, kid-safe play area, dog run, community and semi-private outdoor dining, swings, fire pits, projector screen and a platform stage for outdoor events. e. Other Public Facilities: The Proposed Project is a brew pub that would include an event space, an outdoor dining and recreational/entertainment area with on and off-premises sales and consumption of alcoholic beverages and a coordinated sign program. The Proposed Project would not generate an increase of new residents that may utilize library facilities in the City. The City of Anaheim Public Library system consists of a Central Library, eight branches, the Heritage House (former Carnegie Library), and a BookMobile. There is no population increase as part of the Proposed Project. As a result, impacts associated with library services and facilities would be less than significant. f. Wastewater/Sewer: The Proposed Project would be served by the Anaheim Public Works Department for wastewater (Sanitary Sewer) collection service. The Proposed Project is located within a developed area and there is an existing Public wastewater (Sanitary Sewer) main in Orangewood Avenue, adjacent to the Proposed Project. The Proposed Project would be required to connect to the existing wastewater (Sanitary Sewer) line. The existing wastewater facilities are not identified as deficient in either the “Existing” or “Build-out” conditions in the latest Combined Central Anaheim Area Master Plan of Sanitary Sewers. Based on the anticipated generation of wastewater (sewage) from the Proposed Project relative to the capacity that is available, no significant impacts on existing wastewater infrastructure would occur and the existing facilities would be adequate to serve the wastewater collection requirements of the Proposed Project. Impacts to wastewater treatment facilities (OCSD) would be less than significant. g. Storm Water Drainage: On-site grading and drainage improvements proposed in conjunction with the proposed site work would be required to meet the City’s and Orange County Flood Control District’s (OCFCD) flood control criteria including design discharges, design/construction standards and maintenance features. All new development projects in the City are also required to include specific design Best Management Practices to ensure that no storm water runoff generated on site would be allowed to leave the site without pre-treatment for urban pollutants. The Proposed Project would not alter any drainage pattern in a manner that would result in substantial erosion or siltation on or offsite. The Proposed Project would not involve an alteration of the course of a stream or river. Erosion and siltation impacts potentially resulting from the project would, for the most part, occur during the Proposed Project’s site preparation and earthmoving phase. Implementation of the NPDES permit requirements, as they apply to the site, would reduce potential erosion, siltation, and water quality impacts. Less than significant impacts would occur. h. Water Supplies: The City of Anaheim receives water from two main sources: the Orange County Groundwater Basin, which is managed by the Orange County Water District (OCWD), and imported water from the Metropolitan Water District of Southern California (MWD). Groundwater is pumped from 18 active wells located within the City, and imported water is delivered to the City through seven treated water connections and one untreated connection. According to the City of Anaheim 2015 Urban Water Management Plan (UWMP), local groundwater has been the least expensive and most reliable source of water supply for the City. The City depends heavily on the groundwater from the Orange County Groundwater Basin each year. The Proposed Project includes the development of a new service station with convenience market at the same location of a similar use. Due to the similar size of the project, the supply of local water needed to support the use is not substantial. Therefore, the production rates of local wells would not be significantly impacted. The Proposed Project would also result in similar amounts of impervious surfaces than what currently exist on the site. Therefore, the development would not result in a significant deficit in aquifer volume or a lowering of the local groundwater table. Less than significant impacts to groundwater supplies would occur. i. Solid Waste Disposal: Assembly Bill 939 requires local jurisdictions to divert at least 50 percent of their solid waste into recycling. As of 2012, the City is diverting approximately 65 percent of its waste into recycling. Waste from the City is currently being diverted to the Olinda Alpha Landfill in the City of Brea, permitted to accept approximately 8,000 tons of waste per day. In April, 2016 Assembly Bill 1826 requires businesses in California to recycle their organic waste based on the amount generated per week. The Proposed Project’s contribution of solid waste would be minimal and would not significantly impact landfill operations. No significant impacts would occur. j. Electricity: k. Natural Gas: l. Telephone Service: m. Television Service: The project site is located in a built-out, urban setting. The site and the surrounding properties are fully served by various utility service providers. There are no anticipated significant service or system upgrades needed to serve the proposed restaurant use. Any increase in demand for these services would be considered to be less than significant. ** Authority: See Public Resources Code Section 21083 and Section 15332 of Title 14 of the California Code of Regulations. DETERMINATION: I find that the answers given above are adequately supported by the information sources cited following each question and that the effects of the proposed project are typical of those generated within that class of projects (i.e., Class 32 – Infill Development Projects) characterized as in-fill development meeting the conditions of Section 15332 of Title 14 of the California Code of Regulations. The proposed project will not cause a significant effect on the environment and is, therefore, categorically exempt from the requirement for the preparation of environmental documents under the California Environmental Quality Act. 11/17/16 Signature of City of Anaheim Representative Date Christine Saunders, Associate Planner (714) 765-5238 Printed Name, Title Phone Number 200 S. Anaheim Blvd. Suite #162 Anaheim, CA 92805 Tel: (714) 765-5139 Fax: (714) 765-5280 www.anaheim.net City of Anaheim PLANNING DEPARTMENT There is no new correspondence regarding this item.